Chemicals

Amount

Purchase of Chemicals

Anti-phospho-eNOS/NOS III (Thr495) Antibody, rabbit monoclonal Properties: Biological source: Rabbit Quality Level: 100 Antibody form: Culture supernatant Antibody product type: Primary antibodies Clone: Monoclonal Species reactivity: Bovine Technique: Western blot: suitable Isotype: IgG, NCBI accession no.: NM_000603 UniProt accession no.: P29474 Target post-translational modification: Phosphorylation (pThr495) Gene Information: Mouse ... Nos3(287024) Specificity: Predicted cross-reactivity with human, rabbit, mouse and rat Recognizes phosphorylated eNOS/NOS III. Immunogen:, Peptide containing the sequence KK[pT]FK in which pT corresponds to phosphothreonine at residue 495 of human eNOS/NOS III Application: Western Blot Analysis: 1:2,000-1:10,000 dilution Target description: 135 kDa, Linkage: Replaces: 05-811 Physical form: Cultured supernatant in 0.05% sodium azide

Anti-GAPDH Antibody, mouse monoclonal, GAPDH-71.1 Properties: Biological source: Mouse Quality Level: 200 Conjugate: Unconjugated Antibody form: Purified from hybridoma cell culture; Purified immunoglobulin Hybridoma GAPDH-71.1 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with rabbit GAPDH (glyceraldehyde-3-phosphate dehydrogenase). Antibody product type: Primary antibodies Clone: GAPDH-71.1, monoclonal Form: Buffered aqueous solution Mol. Wt.: Antigen ~37 kDa Species reactivity: Bovine, turkey, canine, chicken, monkey, mink, mouse, human, rabbit, rat, hamster Should not react with: Prokaryotes Concentration: ~1 mg/mL Technique Immunocytochemistry: suitable , Indirect ELISA: suitable Microarray: suitable, Western blot: 0.025-0.05 μg/mL using A431 total cell extract Isotype: IgM, UniProt accession no.: P04406 Application: Research pathology, Western Blot, immunostaining, immunocytochemistry, indirect ELISA and microarray. Storage temp.: −20°C Target post-translational modification: Unmodified Gene Information: Human ... GAPDH(2597), Mouse ... Gapdh(14433), Rat ... Gapdh(24383) Specificity: Monoclonal Anti-GAPDH should recognizes human, monkey, bovine, canine, rat, mouse, hamster, mink, rabbit, chicken, and turkey GAPDH. It should not cross-react with non-vertebrate and prokaryotic species. Immunogen: Rabbit GAPDH. Physical form:,Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide. Storage and Stability:, For continuous use, storage at 2-8°C for up to one month. For extended storage: -20°C

Anti-HIPK2 Antibody, clone 3Z5P6, Rabbit Monoclonal Biological source: Rabbit Quality Level: 100 Material: Colorless Clone: 3Z5P6, monoclonal Form: Liquid Species reactivity: Human Concentration: 0.3mg/mL Technique(s): Immunofluorescence: 1:50 - 1:200 Western blot: 1:500 - 1:2000 Color: Colorless Isotype: IgG Immunogen sequence STSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYE UniProt accession no.: Q9H2X6 Storage temp.: −20°C Target post-translational modification: Unmodified Gene Information: Human ... HIPK2 (28996) Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HIPK2 (Q9H2X6). Physical Form: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. Application WB, IF/ICC

THE PRECISION SCIENTIFIC CO CBE (BID ID -1267191)