Chemicals

Amount

Purchase of Chemicals

Anti-phospho-eNOS (pSer1176) antibody produced in rabbit Properties: Biological source: Rabbit Quality Level: 100 Conjugate: unconjugated Antibody form: Affinity isolated antibody Antibody product type: Primary antibodies Clone: Polyclonal Form: Buffered aqueous solution Mol wt.: Antigen 133 kDa Species reactivity: Rat, human, mouse Concentration ~1 mg/mL Technique ELISA: 1:20000 Western blot: 1:500-1:1000 NCBI accession no. P29474 UniProt accession no. P29474 Storage temp.: −20°C Target post-translational modification: Phosphorylation (pSer1176) Gene Information: Human ... NOS3(4846) Immunogen: The antiserum was produced against synthesized peptide derived from human eNOS around the phosphorylation site of Ser1176. Immunogen Range: 1144-1193 Physical form: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Monoclonal Anti-HIPK1 antibody produced in mouse Properties: Biological source: mouse Quality Level: 100 Conjugate: unconjugated Antibody form: Purified immunoglobulin Antibody product type: Primary antibodies Clone: 4C2, monoclonal Form: Buffered aqueous solution Mol. Wt.: antigen ~37.11 kDa Species reactivity: Human Technique(s): Capture ELISA: suitable Immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable Indirect ELISA: suitable Indirect immunofluorescence: suitable Western blot: 1-5 μg/mL Isotype: IgG2aκ NCBI accession no.: BC028408 UniProt accession no.: Q86Z02 Storage temp.: −20°C Target post-translational modification: unmodified Gene Information: human ... HIPK1(204851) Immunogen: HIPK1 (AAH28408, 330 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS Physical form: Solution in phosphate buffered saline, pH 7.4

Anti-NOS1 Antibody, clone 1F14 ZooMAb® Rabbit Monoclonal Properties: Biological source: Rabbit Quality Level: 200 Recombinant: Expressed in HEK 293 cells Conjugate: Unconjugated Antibody form: Purified antibody Antibody product type: Primary antibodies Clone: 1F14, monoclonal; Recombinant monoclonal Form: Lyophilized Mol. Wt.: Calculated mol wt ~160.97 kDa; Observed mol wt ~165 kDa Species reactivity: Human Enhanced validation: Recombinant expression Technique Immunocytochemistry: suitable Immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable Western blot: suitable Isotype: IgG UniProt accession no.: P29475 Storage temp.: 2-8°C Target post-translational modification: Unmodified Immunogen: His-tagged recombinant fragment corresponding to the first 300 amino acids from the N-terminal region of human NOS1. Physical form: Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL. Reconstitution: 300 μg/mL after reconstitution at 25 μL per vial. Storage and Stability Recommend storage of lyophilized product at 2-8°C. Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage.

THE PRECISION SCIENTIFIC CO CBE (BID ID -1267159)