Poviding And laying Foothpath And repairing Foothpath at Diff area And Diff. TP roads Under Dy. mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff Budget In Naranpura ward Of WZ (ARC-1)

Name of Work :-Poviding And laying Foothpath And repairing Foothpath at Diff area And Diff. TP

roads Under Dy. mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff Budget In

Naranpura ward Of WZ (ARC-1)

Item Description Qty Rate per Amount

Excavation for foundation upto 1.5 mt. depth

including sorting out stacking of useful

material & disposing of excavated stuff upto

50 mt. lead loose or soft soil.

Dismantling the following including loading,

unloading and disposal of unserviceable

material for all lead or as directed by

Engineer-In-Charge and stacking the

serviceable material and backfilling the

resulting trenches and pits complete.

a central verge -kerb stone 8.00 Rmt

Dismantling tiled or stone floors laid in mortar

including stacking of serviceable material and

disposal of uservicalble material with all lead

Demolition & disposal of unservisable material

c with all lead and lift for unreinforeced 348.10 Cmt

concrete. (AMC sor)

Demolition of brick work & stone masonry

including stacking of serviceable materials and

disposal of unserviceable materials with all

lead and lift (1) In cement mortar.

Demolition including stacking of serviceable

e materials and disposal of unserviceable 604.74 Cmt

materials with all lead and lift. (I) R.C.C work.

Labour Work For Fixing Any Kind Of Paving

With Cement Pointing In Cm 1:2, Including

Watering, Ramming Etc Comp. As Dir.For

(A)For Water Table & Kerb On Sand Bedding

(a) As Per Requirement To Fix The C.C.Block / 30.80 Rmt

Nibhada Stone In Line & Level

(A)Laying On Sand Bedding As Per

(b) Requirement To Fix The C.C.Block / Nibhada 68.64 Smt

Stone In Line & Level

Providing, laying, spreading and compacting

graded stone aggregate to wet mix macadam

specification including premixing the Material

with water at OMC in mechanical mix plant

4 carriage of mixed Material by tipper to site,

laying in uniform layers in subbase / base

course on well prepared surface and

compacting with vibratory roller to achieve

the desired density as per MoRTH clause

(A) Supply of WMM Cmt

(B) Laying of WMM 111.87 Cmt

Conveyance charge of earth, lime,

murrum, building rubbish, manure,

garbage, sludge, excavated rock, fly ash,

aggregates of any kind executed outside the

road site. Rate also includes spreading &

5 levelling etc complete. Internal conveyance

above 50 mt done within the work site is not

payable. (R&B 2021-22 Statement No.5 Page

no.5 & RA Approved St.Com.Res

a) Lead up to 1 Km.

b) Lead From 1Km to 2 Km.

c) Lead From 2 Km to 3 Km.

d) Lead From 3 Km to 4 Km.

e) Lead From 4 Km to 5 Km.

f) Lead From 5 Km to 10 Km.

g) Lead From 10 Km to 15 Km.

Leveling Or Orientation Of Existing Gully Trap

Chamber Incl. Nece. Masonry In Cm 1:6 And

Plaster In Cm 1:3 Etc. Using Old G.T.Stone And

Cover Etc. Comp.Sub:-

Repairing damaged M.H. and rasing M.H. up

to road level incl. removing damaged brick

work and repairing by brick masonry in C.M.

7 1:5 and plaster in C.M. 1:3 and fixing C.I. steps

and existing MH sheet cover, removing the

from MH and carting the same as directed.

(A) Up to 0.15 mt. (@ Two Coarse) 728.82 No

(b) up to 0.35mt. (@ Four Coarse) 5.00 No

(C ) up to 0.65 mt. (@ Seven Coarse) 3.00 No

Extra Rate Over Item Of Excavation Of Earth

For Excavation Of Asphalt Pavement / Rcc Of

Thickness Upto 0.20 Meter Including

8 Demolishing The Asphalt

Carpet,Metal,Soiling/Cutting Reinforcement

Etc.Comp. With Stacking The Material As

Directed. Sub:-

(a) A) Upto 0.20 Meter Thickness (By Manual) 70.40 Smt

B) 0.20 Meter To 0.30 Meter Thickness (By

(b) Breaker Machine Including Cost Of Operator, 176.00 Smt

Fuel, & Transportaion Etc Complete.

(C) 0.30 Meter & Above (By Breaker Machine

(C ) Including Cost Of Operator, Fuel, & 311.08 Smt

Transportaion Etc Complete.

Supplying and fixing of 380 mm H x 300 mm L

x 200 mm B Kerb block for Central Verge in M-

20 grade using 20 mm nominal size black trap

aggregate of Sevaliya/Timba or equivalent

quality for pre-cast blocks, reasonably

exposed finish/ formwork, mould with well

equipped with vibratory system for kerb

stones of approved design including curing,

etc. complete, including the cost of formwork

etc. complete. The rate shall also include

necessary cutting of asphalt, fixing the Kerb

stones in line and level on 5 cm thick sand

bedding with necessary equipments and

materials. The rate shall also include the flush

pointing in CM (1:3) for all joints of the

kerbstones. Filling of zari alone the sides of

the kerb stone fixed with Bituminous concrete

mixed in proper position as directed by

Engineer in change to form a portable

mixture. In any case Gravel or such type of

materials shall not be allowed for

productiona) Laying on 5 cm thick Sand

Supplying and fixing of 300 mm-L x 150 mm-B

x 380 mm-H Kerb block for Footpath in M-20

grade using 20 mm nominal size black trap

aggregate of Sevaliya/Timba or equivalent

quality for pre-cast blocks, reasonably

exposed finish/ formwork , mould with well

equipped with vibratory system for kerb

stones of approved design including curing,

etc. complete, including the cost of formwork

etc. complete. The rate shall also include

necessary cutting of asphalt, fixing the Kerb

stones in line and level on 5 cm thick sand

bedding with necessary equipments and

materials. The rate shall also include the flush

pointing in CM (1:3) for all joints of the

kerbstones. Filling of zari alone the sides of

the kerb stone fixed with Bituminous concrete

mixed in proper position as directed by

Engineer in change to form a portable

mixture. In any case Gravel or such type of

materials shall not be allowed for production.

a) Laying on 5 cm thick Sand Bedding

Pre cast concrete kerb Providing and fixing

M25 Grade of concrete precast exposed / Fair

finish / texture finish kerb stones of approved

make as per approved sample of any size and

any type. Kerbs shall be fixed on the

foundation prepared as per approved design.

The rate shall also include for erecting and

fixing the pieces in position for complete kerb

system with chamfered type of kerbs including

necessary accessories of kerb like radius kerb,

angles and quadrant kerbs, droplet kerbs etc. 10.00

complete as per drawing. Kerb shall be fixed

as paper joint without any jointing material.

However cement mortar shall be provided at

the backside of kerb stone joint. (Sample must

be approved) Cost of excavation, cutting

base , side filling shall includes as directed

engineer - incharge in above item description

as per BOQ (a) 450 hight x 600x 150 mm high

Pre cast concrete kerb Providing and fixing

M25 Grade of concrete precast exposed / Fair

finish / texture finish kerb stones of approved

make as per approved sample of any size and

any type. Kerbs shall be fixed on the

foundation prepared as per approved design.

The rate shall also include for erecting and

fixing the pieces in position for complete kerb

system with chamfered type of kerbs including

necessary accessories of kerb like radius

kerbs, angles and quadrant kerbs, droplet

kerbs etc. complete as per drawing. Kerb shall

be fixed as paper joint without any jointing

material. However cement mortar shall be

provided at the backside of kerb stone joint.

(Sample must be approved) Cost of

excavation, cutting , base , side filling shall

includes as directed engineer - incharge in

above item description as per BOQ (b) 380 x

600 x 150 mm high Footpath kerb.

Providing & laying Mountable type Central

Verge including casting of Kerb of size 15.00 x

32.50 Cm by mechanical Kerb casting

machinery and oil paint colour to Center

verge (Kerb) by Yellow/white and Black patta

13 (Three Coat) one coat of priming & two coat 361.75 Rmt

of oil Paint including cost of material required

for paint and all labourworketc complete as

per direction, detailed drawing and instruction

of engineer incharge .(Including Epoxy Piant of

Approved Quality) (Central Verge)

Supplying and fixing for central verge 230 mm

L x 235 mm Width x 680 mm H Supplying &

Fixing in M-20 grade using 20 mm nominal size

black trap aggregate of sevaliya/timba or

equivalent quality for pre-cast

blocks,reasonably exposed

finish/formwork,mould with well equipped

with vibratory system for kerb stones of

approved design including

curing,etc.complete,including the cost of

formwork etc.complete.THe rate shall also

include necessary cutting of asphalt,fixing the 10.00

kerb stones in line and level on 5 cm thick

sand bedding with necessary equipments and

materials.The rate shall also include the flush

pointing in CM(1:3)for all joints of the

kerbstones.Filling of Zari alone the sides of the

kerb stone fixed with bituminous concrete

mixed in proper position as directed by

engineer in charge to form a portable

mixture.In any case gravel or such type of

materials shall not be allowed for production.

Providing and Laying of Rubber Moulded

Paver Block Grey/Coloured 60 mm thick, M-35

Grade of any size ; shape (Usually Uni-Paver

Blocks) using black trap good quality

aggragate of 20 mm nominal size for footpath,

parking areas, service lanes and other

areas as mentioned in the drawing /

instruction of engineer in charge. Cost

includes formworks using rubber mould, Rate

providing and laying paver blocks as per

required grading and specification. The paver

block shall be mechanically compacted. The

work of paving blocks shall be executed in

line and level by skill mason of flooring work

only. It should be laid in such a way that the

no cutting of the paver block to be necessary.

if cutting of paver block necessary then it

should be cut by machine only and carting.

The finished surface of the paver block shall

have resonably good, plain finished. Paver

blocks shall be compacted and shall be relaid

if necessary. Gravel or such type of materials

shall not be allowed for production. Laying

on 5cms thick sand beddding.

Providing and laying of interlocking grey paver

blocks of high density 80mm thick made from

M-40 grade concrete using 6 mm to 20 mm

machine crushed well graded stone aggregate,

sand of approved quality, OPC 53 grade

cement with contractor's own concrete mix

design as approved by AMC, for parking, road.

Cost Includes formwork, using rubber/FRP

mould, laying paver block as per required

grading and specification laid paver block shall

be mechanically compacted. The work of the

16 paving blocks shall be executed in line and 572.00 Smt

level by skilled mason of flooring work only. It

should be laid in such a way that the no

cutting of the paver block to be necessary.

Cutting of paver block by machine cut only

and carting to be done. The Finished surface

of the Paver Block shall have reasonably good

plain finish. Paver blocks shall be compacted

and shall be re-laid if necessary. Gravel or

such type of materials shall not be allowed for

production. Laying on 5 Cms thick sand

Paver Block Providing and laying shot blasted

Non - interlocking, Paver blocks of specified

thickness, size, grade of concrete and colour

machine made and blasting by automatic shot

blasting machine and high density of as per

approved sample of approved make for

footpath, parking areas, service lanes,cross

over and other areas as mentioned in the

drawing. Including providing and laying 50 mm

thick averave bedding layer of coarse sand

below paver block as per required grading and

specification. Laid paver block shall be

mechanically compacted. The work of the

paving blocks shall be executed in line and

level by skilled mason of flooring work only.

Small size of paver block with same

specification shall be used at residue or at

end. It should be laid in such a way that the no

cutting of the paver block to be necessary. If

cutting of paver block shall be required , than

cut by machine only and laying to be done by

skilled flooring mason. The finished surface of

the paver block shall have coarse sand Texture

Finish. Pave blocks shall be compacted and

shall be re-laid if necessary. Actual laid area

shall be measured and paid without any

wastage. (A) 60 mm thick M-35 grade Grey

Paver block of size 200mm x 200mm.

Paver Block Providing and laying shot blasted

Non - interlocking, Paver blocks of specified

thickness, size, grade of concrete and colour

machine made and blasting by automatic shot

blasting machine and high density of as per

approved sample of approved make for

footpath, parking areas, service lanes,cross

over and other areas as mentioned in the

drawing. Including providing and laying 50 mm

thick averave bedding layer of coarse sand

below paver block as per required grading and

specification. Laid paver block shall be

mechanically compacted. The work of the

paving blocks shall be executed in line and

level by skilled mason of flooring work only.

Small size of paver block with same

specification shall be used at residue or at

end. It should be laid in such a way that the no

cutting of the paver block to be necessary. If

cutting of paver block shall be required , than

cut by machine only and laying to be done by

skilled flooring mason. The finished surface of

the paver block shall have coarse sand Texture

Finish. Pave blocks shall be compacted and

shall be re-laid if necessary. Actual laid area

shall be measured and paid without any

wastage. (A) 80 mm thick M-35 grade Grey

Paver block of size 200mm x 200mm.

Labour work of fixing kurb any design of

central verge, (both side) footpath kurb,

items includes necessary excavation, asphalt

cutting of any thickness, erecting in line and

19 position and pointing with cement mortar 5.00 136.40 Rmt

(1:3), watering, etc complete, filling with zari

along the side of the kurb, the kurb stone fix

prepared with bitumnious top surface, as

directed by engineer in charge.

Provdg. & laying cement concrete 1:5:10 (1

cement : 5 coarse sand : 10 hand broken stone

aggregates 40 mm nominal size) and curing 100.00

complete excluding cost of form work in.

Providing TMT Bar FE500D reinforcement for

R.C.C. Work including bending,binding and

placing in position complete upto floor two

Providing and Casting in situ ordinary

cement concrete M200 for R.C.C. Raft and

cutt off walls including necessary shuttering

laying, vibrating, ramming and curing

complete.(B) Walls, fom top of foundation

level upto floor two level (upto 10ton).

Providing and setting 50 to 60 mm thick rouge

kotah stone water table in line, level and in

required gradient including 25 mm thick

beddcing in C.M. 1:6 (1 Part of cement : 6 Part

of coarse sand) with sufficient ramming

consolidation. Providing joints in C.M. 1:3 (1

Part of cement : 3 Part coarse sand) and

smooth pointing in C.M. 1:1 (1 Part of Cement,

1 Part of coarse sand) including watering etc.

complete and as per details in tender

specification & as directed by engineer in

Size : 1' x 1'(40 to 50 mm thick) 103.52 Rmt

Construction of RCC nosing in central verge

using M-200 grade cement concrete. The item

includes cost of centering & shuttering,

24 reinforcement, both side cement plaster in 5.00 No

C:M 1:3 mortar & curing etc. complete. Half

round portion of the nosing shall be made by

using mild steel.

Painting Two Coats on divider and footpath

curb surface / New Concrete Surface ( Painting

two coats after filling the surface with

synthetic enamel paint in all shades on new

plastered concrete surfaces) (R & B SOR 2012-

13 Item No. 8.8 page-49)

Finishing Wall With Apex Ultima Acrylic Paint

Of " Asian Paint " Or Equivalent On Wall

Surfaces (Two Coats) To Give Required Even

Shade After Application Of Exterior Primer Of

Approved Brand & Manufactures After

Thoroughly Brushing The Surface To Remove

All Dirt & Remains Of Loose Powered

P/F Name Board of 45X60 cm size showing

grant detail with necessary painting & writing

letters as per given inst. & design etc

Providing and laying in position Ready Mixed

M-200 grade concrete for reinforced cement

conctere work , using cement content as per

approved Design Mix manufactured in fully

automatic batching plant and transported to

site of work in transit mixer for a lead up to

kms having continuous agitated mixer,

manufactured as per mix design of specified

grade for reinforced cement concrete work

including pumping of R.M.C. from transit

mixer to site of laying, excluding the cost of 90.00

centering shuttering finishing and

reinforcement including cost of admixtures in

recommended proportions as per IS: 9103 to

accelerate/ retard setting of concrete,

improve workability without impairing

strength and durability as per direction of the

Engineer - in - charge. Without Fly Ash (Min

cement level as per latest IS 456 shall be

Providing and supplying of labour for

necessary manual excavation, cleaning,

Shifting of Material Or any other, or for any

other work as directed by Engineer In charge.

Labour charges - Mazdoor (Male) 493.00 Each

Contractor'sSign Addl.C.E.

MobilNo:- (westzone)

AHMEDABADMUNICIPALCORPORATIONENGINEERDEPARTMENT

TECHNICALSPECIFICATION

Nameof Work :- Poviding And laying Foothpath And repairing Foothpath at Diff area And

Diff. TP roads Under Dy. mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff

Budget In Naranpura ward Of WZ (ARC-1)

GeneralTechnicalSpecificationSection

FollowingtechnicalspecificationsshallbeapplicabletotherelevantitemsofBOQ

Earth work in cutting in all sorts of soil & murrum incldg.conveyaning ,breaking clods spreading the stuff as &

where dire. With in a lead of 50 mt. from end of cutting.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Conveyance charge of earth, lime, murrum, building rubbish, manure,

garbage, sludge, excavated rock, fly ash, aggregates of any kind Including

spreading & levelling etc. complete.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Dismantling the following including loading, unloading and disposal of unserviceable material for all lead or as directed

byEngineer-In-Chargeand stackingtheserviceable materialandbackfillingthe resultingtrenchesandpitscomplete.

a. centralverge-kerbstone.

b. Dismantlingtiledorstonefloorslaidinmortarincludingstackingofserviceablematerialanddisposalofunserviceablem

aterialwith all lead andlifts.

c. Demolition&disposalofunserviceablematerialwithallleadandliftforunreinforcedconcrete.

d. Demolitionofbrickwork&stonemasonryincludingstackingofserviceablematerialsanddisposalofunserviceablemat

erialswithalllead andlift(1)In cementmortar.

e. Demolitionincludingstackingofserviceablematerialsanddisposalofunserviceablematerialswithallleadandlift.(I)R.C

Thedemolitionshallconsistofdemolitionofoneormorepartsofthestructureasspecifiedorshowninthedrawings.Demolition implies

taking up or down or breaking up. This shall consist of demolishing whole or part of work including all relevantitemasspecified or

shownin the drawings.

The demolition shall always be planned before hand and shall be done in reverse order of the one in which the structure

wasconstructed.Contractorisfully responsibleforproperandsafedemolition.

Necessary dropping, shoring and under pinning shall be provided for the safety of the adjoining work or property, which is to

beleft intact, before dismantling and demolishing is taken up and the work shall be carried out in such a way that no damages

iscaused tothe adjoiningproperty.

Wherever required, temporary enclosures or partitions shall also be provide 1. Necessary precautions shall be taken to keep

thedust nuisance downasandwhere necessary.

Dismantling shall be commenced in a systematic manner. All materials which are likely to be damaged by dropping from a

heightor demolishing roof, masonry etc. shall be carefully dismantled first. The dismantled articles shall be properly stacked as

directed.All materials obtained from demolition shall be the property of Government unless otherwise d shall be kept in safe

custody untilhanded over totheEngineer-in-charge.

Any serviceable materials, obtained during dismantling or demolition shall be separated out and stacked properly as

directed,withalllead andlift.Allunserviceablematerials, rubbishetc.shallbstacked asdirectedby theEngineer-in-charge.

Oncompletionofwork,thesiteshallbeclearedofalldebrisrubbishandcleanedasdirected.

Modeofmeasurements&payment:

Measurementsofallworkexcepthiddenworkshallbetakenbeforedemolitiondismantlingandnoallowanceforincreaseinbulk shall be

allowed. The demolition of lime concrete shall be measured under this item. Specification for deduction for

voids,openingsetc.shall beonsamebasisasthat employedforconstructionofwork.

All work shall be measured in decimal system as fixed in its place subject to the following limits, unless otherwise

statedhereinafter : (a) Dimensions shall be measured to the nearest 0.01 mt. (b) Area shall be worked out to the nearest 0.01 sq.

mt.(c,d,e)Cubicalconnectionshallbe worked outto the nearest 0.01 Cu.m.

Therateshallincludecostofalllabourinvolvedandtoolsusedindemolishinganddismantlingincludingscaffolding.Therateshall also

include the charges for separating out and stacking the serviceable materials properly and disposing the unserviceablematerials

with all lead and lift. The rate also includes for temporary storing for the safety of the portion not required to be

pulleddownorofadjoiningpropertyandprovidingtemporary enclosuresorpartitions whereconsidered necessary.

The rate shall be for a unit of one cubic

metre.For Dismantlingof Tiled Floor:

The relevant specifications shall be followed except the dismantling of tiled or stone floors laid on mortars shall be

doneDismantling implies carefully taking up or down or these are fixed by nail screws bolts etc. the shall be taken out with

Modeofmeasurement&Payment:

Thesupportingmaterials suchas joints beams if

anyetc.shallbemeasuredseparately.Therateshallincludestackingtheunserviceablematerialsasdirectedwillleadandlift.

Therateshallbeforaunitof(a)RMT(b)one sq.Meter(C) CMT(d)Cu.m(e)Cu.m

Extra rate over item of excavation of earth for excavation of asphaltpavement / RCC of thickness up to 0.20 meter

includingdemolishing the asphalt carpet, metal, soiling/cutting Reinforcement etc. comp. with stacking the material as

directed. (a) upto 0.20 meter thickness (By Manual)(b) 0.20 to 0.30 meter (By any type ofBreaker Machine or R.C.C.Cutter

machine includingcost of operator, fuel, & transportation etc complete.(c) 0.30 meter & above (By any type of Breaker

Machine or R.C.C.Cuttermachineincludingcostofoperator,fuel,&transportationetc complete.

TheItemshallbecarriedoutasperItemdescriptionandasperinstructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.

Therateincludesthecostofexcavationofbituminousmacadami.e.bituminouslayersonlylikeDBM,BCetcincludingthelabours,tools,equip

mentandallotherincidentalexpenses.NonBituminousSub-layer/Subbasearenotconsideredinthisitem.

WorkshallbecarriedoutmanuallyorbyMachineryaspersiterequirements.Themode

ofpaymentforthisitemshall beon Smt. Basis.

Supplying and fixing of 380 mm H x 300 mm L x 200 mm B Kerb block for Central Verge in M-20 grade using 20 mm nominal

size black trap aggregate of Sevaliya/Timba or equivalent quality for pre-cast blocks, reasonably exposed finish/

formwork, mould with well equipped with vibratory system for kerb stones of approved design including curing, etc.

complete, including the cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb

stones in line and level on 5 cm thick sand bedding with necessary equipments and materials. The rate shall also include the

flush pointing in CM (1:3) for all joints of the kerbstones. Filling of zari alone the sides of the kerb stone fixed with

Bituminous concrete mixed in proper position as directed by Engineer in change to form a portable mixture. In any case Gravel

or such type of materials shall not be allowed for productiona) Laying on 5 cm thick Sand Bedding

Thespecifictionoffollowingmaterialsshallbeconformingwithspecificationmentionedforrelaventmaterial/itemsinGeneraltechnicalspe

cification for buildingworkofR&B DepartmentofGujarat.

Water shall conform to M-

Gradedstoneaggregate20 mm.nominal sizetoM-10

Contractor shall have to manufacture the blocks as per the dimensions given in the drawing. Specific machineries shall be used

tomanufacturetheprecastblocks.Thesemachineriesshouldbecompatibletoproduceblocksofrequiredstrengthanddimensions. The

machine shall contain hydraulic Press or advanced equipment to generate required compaction & Grade andfinish. Moulds/ Steel

Plates/ Dies of the machine shall be dimensionally checked & to be got approved before commencing theproduction. Contractor

shall prepare proper Drying Yard for keeping the blocks before curing. The drying yard shall be

levelledandcoveredsothatnoshrinkagecracksareformed.Contractorshallprepareadequatesizecuringpondtocuretheblocksfornotles

sthan21Days.Noothermeansofcuringshallbeallowed.ThetechnicalspecificationofconcreteshallconfirmtoIS456-

2000. The concrete mix is not required to be designed and only nominal mix as per IS: 456-2000 shall be followed. The

proportionof the concrete mix shall be 1:1.5:3 (1 cement: 1.5 coarse sand: 3 graded stone aggregate 20 mm. nominal size) by

volume.Concrete work shall have fairly exposed concrete surface or as specified in the item. The designation ordinary M-10, M-

15, M-20,M-25 specified as per I.S. corresponds approximately to 1:3:6, 1:2:4, 1:1.5:3 and 1:1:2 nominal mix of ordinary

concrete, byvolume respectively. The ingredients required for ordinary concrete containing one bag of cement of 50 Kg. by

weight (0.0342m3.) for different proportions of mix shall be as per IS 456-2000. The proportion of the aggregate for the kerb

stone shall bemodified as per the approval of the engineer-in-charge. The water cement ratios shall not be more than those

specified as per IS.The cement of the mix shall be increased, if the quantity of water in a mix has to be increased to overcome the

difficulties ofplacement and compaction so that the water cement ratio specified in the table is not exceeded. The maximum size

of coarseaggregate shall be as large as possible within the limits specified but in no case greater than 1/4th of the minimum

ofthemember,providedthattheconcretecanbeplacedwithoutdifficultysoastosurroundallreinforcementthoroughlyandtofill the

corners of the form. For reinforced concrete work, coarse aggregates having a nominal size of 20 mm. are generallyconsidered

satisfactory. Admixture shall be used in concrete only with approval of the Engineer-in-charge based upon theevidence that with

the passage of time, neither the compressive strength of concrete is reduced nor are other requisite qualitiesofconcrete impaired

bythe useofsuch admixtures.

Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50 kg weight. The volume

ofone such bag can be taken as 0.0342 m3. Boxes of suitable sizes shall be used for measuring sand and aggregate. The size of

theboxes (internal)shall be 30cm.x30 cm.and38 cm.deep. While measuring the aggregate andsand,the boxshall be filledwithout

shaking ramming or hammering. The proportioning of sand shall be on the basis of its dry volume and in case of

dampsand;allowancesforbulkageshallbe made.

For all work, concrete shall be mixed in a mechanical mixer which along with other accessories shall be kept in first class

workingcondition and maintained throughout the construction. Measured quantity ofaggregate, sand, and cement required for

eachbatch shall be poured into the drum of the mechanical mixer while it is continuously running. After about half a minute of

dry-mixing, measured quantity of water required for each batch of concrete mix shall be added gradually and mixing continued

foranother one and a half minute. Mixing shall be continued till materials are uniformly distributed and uniform colour of the

entiremassisobtainedandeachindividualparticleofthecoarseaggregateshowscompletecoatingofmortarcontainingitsproportionate

amount of cement. In no case shall the mixingbe done for less than 2 minutes after all ingredients have been putinto the mixer.

Mixers which have been out of use for more than 30 minutes shall be thoroughly cleaned before putting in a newbatch. Unless

otherwise agreed to by the Engineer-in-charge, the first batch of concrete from the mixture shall contain only2/3rds of normal

quantityof coarse aggregate. Mixing plant shall be thoroughlycleanedbefore changingfrom one type ofcement toanother.

The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete shall

bedetermined by regular slump tests in accordance with IS: 1199-1959. The slump of 10 mm. to 25 mm. shall be adopted

whenvibratorsare used.

All Moulds shall be cleaned and made free from standing water, dust, snow, or ice immediately before placing of

concrete.Formwork/MetalMould forexposed concrete surface(Ifindicated):

Allthemouldsshallbecheckedforexactdimensionsoftheprecastblocks.Alltheedgesoftheprecastblocksshallconfirmthe

profile of the final drawing & edges/ curvatures of the moulds shall be checked accordingly. Moulds shall be regularly checked

forcorrectnessofdimensionsofBlocks, twists, bendsdueto handling, etc.Beforestartingevery dayswork.

Care shall be taken to set all form work/Mould in perfect line, level (or in required camber or slope as specified) and plumb.

Formwork/Mould propping shall be strong, rigid, and sturdy. The form work/Mouldshall be as per pattern & design shown

indrawings. Form work/Mould shall be done accurately and precisely so as to achieve neat, clean and smooth concrete surface,

inline, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall not be allowed. Before placing

concrete,forms shall be thoroughly cleaned off of all rust, dust, and loose materials. Colourless oil or grease of approved quality

shall beappliedbeforeplacingsteel.Alsotheformworkmaterialwillbeofwood/plywood/steeloranysortofsuchmaterial,as

approved by the Engineer-in-Charge and/or his authorized representative; so that all exposed concrete surfaces have

Forallkindofexposedconcreteworkonlyonebrand(tobeapprovedbytheEngineer-incharge)ofcementshallbeused.

RemovalofMoulds:

Specific time shall be identified for removal of moulds, such that the concrete of the precast blocks shall gain strength

towithstand the stresses generated due to self weight and handling to drying yards without any deformation to shape/

dimensions/edges.

Sufficient time shall be given to the block after it is removed from the mould so that it can gain strength and dry in shade

toprevent anycracksdue to shrinkage. Thisshall be doneindryingyards.

Curingofblockshallbedoneonlyincuringpondandcuringshallbedoneforminimum14days.

Drying period after removing from pond & before delivery to site:Water should be drained of from the block before it is

actuallysent to the site. Time should be provided for proper draining of water which may be present in the block kept for curing

Precautionshallbetakenwhiletransportingoftheblocksto site.

Theblocksshouldbeloadedandunloadedwithduecaresoastoavoidgenerationofstressesleadingtobreakingofblock.Careshould be

taken toprevent the block from breakingduring transporting.

The pits of the size 150mm in width and required depth shall first be excavated, true to line and level. The relevant

specificationsof item A- 1 shall be followed for excavation work. The pits shall be filled with a layer of 50mm. thick sand bedding.

The curbsthen shall be placed in position of which 50mm. shall be below road. Care should be taken to maintain proper line and

level.Thejointsbetween thekerbsshallbepointed withC.M.1:2and curedforminimumsevendays.

Samplingandtestingofconcrete:

Samples from fresh concrete shall be taken as per IS : 1199-1959 and cubes shall be made, curedand tested at 7 days or

daysas per requirements in accordance with IS : 516-1959. A random sampling procedure shall be adopted to ensure that

eachconcrete batch shall have a reasonable chance of being tested i.e. the sampling should be spread over the entire period

ofconcretingandcoverallmixing units.

At least 1 sample shall be taken from each shift. Ten test specimens shall be made from each sample, 5 for testing at 7 days,

andthe remaining 5 at 28 days. The samples of concrete shall be taken on each day of the concreting as per above frequency.

Thenumber of specimens may be suitably increased as deemed necessary by the Engineer-in-charge when procedure of tests

givenabove reveals a poor quality of concrete and in other special cases. The average strength of the group of cubes cast for each

dayshall not be less than the specified cube strength of 200 Kg/cm2 at 28 days. 20% of the cubes cast for each day may have

valueless than the specified strength provided the lowest value is not less than 85% of the specified strength. If the concrete

made inaccordance with the proportions given for a particular grade, does not yield the specified strength, such concrete shall

beclassified as belonging to the appropriate lower grade. Concrete made in accordance with the proportions given for a

particulargrade shall not,however,be placedinahighergrade onthe ground thatthe teststrengthare higherthanthe

minimumspecified. If rock pockets/honeycombs in the opinion of Engineer-in-charge are of such an extent or character so as to

affect thestrength of the structure,materially or toendanger the life of the steel reinforcement, he may declare the concrete

defectiveand requirethe removalandreplacement oftheportionofthe structureaffected.

PrecastKerbStones:

The relevant specifications of concreting as per item above shall be followed except that work shall be carried out for

precastconcrete kerb stones as specified in the item. All Precast members shall be cast at workshop. Sufficient curing shall be

donebefore placement of the samethe method of transporting and placing the precast members shall be as approved by

theEngineer-in-charge. Members shall be so transported that no breakage or undue stresses are induced in them. If required,

allmembers shall have a key provided on both the faces i.e top and bottom surfaces, of adequate size so as to fill the same

withconcrete while laying. The function of this key is to avoid the leakage through the joint between the precast member and

thememberonwhichit islaid.

ModeofMeasurementsandPayment:

Therate shallinclude costof formworkandcost ofreinforcement. Thevolumeoccupiedbyreinforcement shallnot

bedeductedfromR.C.C.work.

The rate shall be for a unit of Rmt.

Supplying and fixing of 300 mm-L x 150 mm-B x 380 mm-H Kerb block for Footpath in M-20 grade using 20 mm nominal size black

trap aggregate of Sevaliya/Timba or equivalent quality for pre-cast blocks, reasonably exposed finish/ formwork , mould

with well equipped with vibratory system for kerb stones of approved design including curing, etc. complete, including the

cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level on

5 cm thick sand bedding with necessary equipments and materials. The rate shall also include the flush pointing in CM

(1:3) for all joints of the kerbstones. Filling of zari alone the sides of the kerb stone fixed with Bituminous concrete

mixed in proper position as directed by Engineer in change to form a portable mixture. In any case Gravel or such type of

materials shall not be allowed for production. a) Laying on 5 cm thick Sand Bedding .

SpecificationasperItem No. 5 onlysizeofkerbasmentionedinAbstract.

Themodeofpaymentforthisitemshall beon Rmt. Basis.

Pre cast concrete kerb Providing and fixing M25 Grade of concrete precast exposed / Fair finish / texture finish kerb

stones of approved make as per approved sample of any size and any type. Kerbs shall be fixed on the foundation prepared as per

approved design. The rate shall also include for erecting and fixing the pieces in position for complete kerb system with chamfered

type of kerbs including necessary accessories of kerb like radius kerb, angles and quadrant kerbs, droplet kerbs etc. complete

as per drawing. Kerb shall be fixed as paper joint without any jointing material. However cement mortar shall be provided

at the backside of kerb stone joint. (Sample must be approved) Cost of excavation, cutting , base , side filling shall includes as

directed engineer - incharge in above item description as per BOQ (a) 450 hight x 600x 150 mm high median kerb.

Themodeofpaymentforthisitemshall beon Rmt. Basis.

Pre cast concrete kerb Providing and fixing M25 Grade of concrete precast exposed / Fair finish / texture finish kerb

stones of approved make as per approved sample of any size and any type. Kerbs shall be fixed on the foundation prepared as per

approved design. The rate shall also include for erecting and fixing the pieces in position for complete kerb system with chamfered

type of kerbs including necessary accessories of kerb like radius kerbs, angles and quadrant kerbs, droplet kerbs etc.

complete as per drawing. Kerb shall be fixed as paper joint without any jointing material. However cement mortar shall

be provided at the backside of kerb stone joint. (Sample must be approved) Cost of excavation, cutting , base , side filling shall

includes as directed engineer - incharge in above item description as per BOQ (b) 380 x 600 x 150 mm high Footpath kerb.

Themodeofpaymentforthisitemshall beon Rmt. Basis.

Providing & laying Mountable type Central Verge including casting of Kerb of size 15.00 x 32.50 Cm by mechanical Kerb casting

machinery and oil paint colour to Center verge (Kerb) by Yellow/white and Black patta (Three Coat) one coat of priming & two

coat of oil Paint including cost of material required for paint and all labourworketc complete as per direction, detailed

drawing and instruction of engineer incharge .(Including Epoxy Piant of Approved Quality)

(Central Verge)

Themodeofpaymentforthisitemshall beon Rmt. Basis.

Supplying and fixing for central verge 230 mm L x 235 mmWidth x 680 mm H Supplying & Fixing in M-20 grade using

mmnominalsizeblacktrapaggregateofsevaliya/timbaorequivalentqualityforpre-

castblocks,reasonablyexposedfinish/formwork,mouldwithwellequippedwithvibratorysystemforkerbstonesofapproveddesigni

ncludingcuring,etc.complete,including the cost of formwork etc.complete.THe rate shall also include necessary cutting of

asphalt,fixingthe kerb stones in line and level on 5 cm thick sand bedding with necessary equipments and materials.The rate

shall alsoinclude the flush pointing in CM(1:3)for all joints of the kerbstones.Filling of Zari alone the sides of the kerb stone

fixed withbituminous concrete mixed in proper position as directed by engineer in charge to form a portable mixture.In any

case gravelor suchtypeof materials shallnotbe allowedforproduction.

Work shall be carried out as per item description including cost of all labour and materials etc. complete as directed.

Generalstandard practice ofwork isapplicable.

ThemeasurementsshallbeonRmtbasis.

Providing and Laying of Rubber Moulded Paver Block Grey/Coloured 60 mm thick, M-35 Grade of any size ; shape (Usually Uni-

Paver Blocks) using black trap good quality aggragate of 20 mm nominal size for footpath, parking areas, service lanes

andother areas as mentioned in the drawing / instruction of Engineer-in-Charge and/or his authorized representative.

Costincludes formworks using rubber mould, Rate providing and laying paver blocks as per required grading and specification.

Thepaver block shall be mechanically compacted. The work of paving blocks shall be executed in line and level by skill mason

offlooring work only. It should be laid in such a way that the no cutting of the paver block to be necessary. if cutting of

paverblock necessary then it should be cut by machine only and carting. The finished surface of the paver block shall have

resonablygood, plain finished. Paver blocks shall be compacted and shall be relaid if necessary. Gravel or such type of

materials shall notbe allowedfor production.Layingon50mmthick sandbedding.

• Layingon50mmthicksandbedding.

Excavation and compaction up to 300 mm in height for footpath paving in all sorts of soil murrum includingsorting

outsandstackingofusefulmaterialsstuffupto 50mt.

The scope of work includes manufacturing, supplying, and lying of precast paver blocks at various Retail outlets. The

workincludes: Verification of the existing site condition and advising our project in charge to lay suitable base course if

required.Contractors are required to satisfy themselves with quality of sub grade, sub-base course before the paver blocks are

laid andsuggest strengthening ifrequired.

Clearing the site by removing all obstacles such as stones, debris etc. for laying of paver blocks. Manufacturing of paver blocks

inyour plant as per requirements in technical specification enclosed. Supplying of paver blocks at site, including handling at

Laying of paver blocks at site as per requirement in technical specification on 50 mm thick sand bedding, within shortest

possibletime the site is public place hence care should be taken to ensure that the routine activities should not be disturbed. The

job oflayingmayrequired tobe carried outduringnightalso.

TestingofpaverblocksshallthroughreputedGovt./NonGovt.Testhouseonlyandsubmissionoftestresultsasperrequirements in

Technical Specifications. AMC reserves the right to carryout test at random. Cost for such tests to be borne byparty. The

contractor shall guarantee that all material and components designed, fabricated, supplied, and laid by him shall befree from any

type of defect due to faulty material and/or workmanship/erection for a period of One year from the date ofcompletion

ofwork.However,thecontractorone year'sshallrender freemaintenance.

TECHNICALSPECIFICATIONS:

PaverBlockManufacturingFacilities:

ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:

ConcreteBlockmakingMachines:

The machine shouldbe capable of producinghighqualityPaverBlocks byobtaininghighlevelof compactionbyapplication of

hydraulic compaction and also by high intensity vibration to the moulds. The machine should haveautomaticcontrol

foruniformityinstrength.

ConcreteBatching&MixingPlant:(Notessential)

The concrete Mix Design should be followed for each batch of materials. The concrete ingredient should be mixed

inconcrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The plant should equipped with

automaticcontrol panel formaintaining watercement ratiofrombatch to batch to obtain concrete of uniform quality

andstrength.Theplantshouldbeequippedwithadequatemechanismformechanizedloadingofrawmaterialsintomixer

andconveyorbeltfortransportationofconcretefrommixertoconcreteblockmakingmachinetomaintainqualityofwet cement.

Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.

Laboratory(Desirablebutnotessential):

The testing equipment should have required in the Laboratory as perthe

following:ACompression testingmachineofadequate capacity.

Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.

Systematic record of test results of various paver blocks manufactured in the

factory.ConcreteMixDesignfor variousgradeofconcreteusedformakingofpaverblocks.

SpecificationsForColouredPaverBlocks:

Coloured concrete paver blocks shall be manufactured as per attached specifications using or equivalent

approvedcolourPigmentof“BAYER”Make“BAYFERROXIRONOXIDEPIGMENTS”withminimumcolourpigmentof3%byweight

of cement. The colour shade shall be “RED” as selected by AMC before commencement of the work. White cement

shallbe used for colored pavers to obtain the desired colour shade. The job also includes providing 50 mm thick sand

beddingto matchthe shadeofthe paverblock.

Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingofthe

Allothertechnicalspecifications&Procedurefortesting,laying&samplingofcolouredpaverswillbeasperattachment.

PaversBlockCharacteristics:

The concrete pavers should have perpendicularities after release from the mould and the same should be retained

untilthe laying. The surface should be reasonably smooth and of anti skid and anti glare type. The paver should have

uniformchamfers to facilitate easy drainage surface run off. The pavers should have uniform interlocking space of 2mm

to 3mmto ensure compacted sand filling after vibration on the paver Surface. The concrete mix design should be

followed foreach batch of materials separately and automatic batching plant is to be used to achieve uniformity in

strength andquality.The pavers shall be manufactured in single layer only. Skilled labour should be employed for laying

blocks toensure line and level of laying, desired shape of the surface and adequate compaction of the sand in the joints.

Thepavers shall be of cement gray colour without any pigment & for coloured pavers refer “specifications for

colouredpave`” The pavers are to be skirted all round with kerbing using solid concrete blocks of size 150mm X 250mm X

380mm.The kerbing should be embedded for 100mm depth. The concrete used for kerbing shall be cured properly for

PaverBlockDimensions:

Shape Unipaver,IshapeordirectedbyAddl.C.E.

Chamfer 4mmto6mmalongtopedges

Colour Naturalcementgreycolourwithoutuseofanypigment.

Forcolouredpaversrefer“specificationsforcolouredpavers”

DimensionalTolerance (+/-)2mmforlength&width,

(+/-)3mmforHeight(Thickness)

TestingofPaverBlocks:

SR.NO *TEST AverageValues Frequency

1. CompressiveStrength Min.35N/Sqmmfor60mm 250Smt/1Test

2. FlexuralStrength Minimum4.5N/Sqmm

3. AbrasionResistance Maximum1.5

4. WaterAbsorption Maximum5.80%

*Samplingandtestingprocedureasperenclosedspecifications

SamplingandTestingProcedureforPaverBlocks

INTERNAL–Averageofminimum3samplesper 5000Blocks.

SamplingforTesting

SamplingofPaverblocks.

Methodofsampling :

Before laying paver blocks, each designated section comprising not more than 50000 blocks, shall be divided into

tenapproximately equalgroups. Threeblocksshallbe drawnfrom each group.

Markingandidentification:

All samples shall be clearly marked at the time of sampling in such a way that the designated section of part thereof,

andtheconsignmentrepresentedbythesample,areclearlydefined.

The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving intransit. Protect

the paving from damage and contamination until they have been tested. The testing shall be carried assoon as possible, after the

sample has been taken. As soon as practicable after sampling. The samples shall be stored inwaterat20degreeC5 degreeC for24

hourspriortotesting.

The item is to be executed as per instructions and to the entire satisfaction of Engineer-in-Charge and/or his

authorizedrepresentativeusingRubbermould andTablevibratorforKerb instead ofmechanicalpresssystem.

Extra rate for excavation of asphalt payment of any thickness including demolishing the asphalt carpet, metal, soling etc.complete

with stacking the materials as directed. The road surface of asphalt shall carefully be opened to full width asdirected by the

Engineer-in-Chargeand/or hisauthorizedrepresentative.

Excavationareashallbeproperlyidentifiedandmarkedinrectangularshape.Theroadcrustshallbeopeneduptoentire depth i.e. including

soling. All the materials shall be separately deposited in such a way and in places as may bedetermined by the Engineer-in-Charge

and/or his authorized representative. In case rubble not being so deposited orbeing mixed up with the excavated materials will

not be allowed for refilling. The cost of materials shall be charged fromthecontractor.The decision oftheC.E.shall befinal and

bindingtothecontract

For detailed specification for Laying of Paver Block on sand bedding, refer R & B Department booklet for

GeneralTechnicalSpecificationforbuilding works.

Therate shallbefor aunitofSMT

Providing and laying of interlocking grey paver blocks of high density 80mm thick made from M-40 grade concrete using 6 mm to

20 mm machine crushed well graded stone aggregate, sand of approved quality, OPC 53 grade cement with contractor's

own concrete mix design as approved by AMC, for parking, road. Cost Includes formwork, using rubber/FRP mould, laying

paver block as per required grading and specification laid paver block shall be mechanically compacted. The work

of the paving blocks shall be executed in line and level by skilled mason of flooring work only. It should be laid in such a

way that the no cutting of the paver block to be necessary. Cutting of paver block by machine cut only and carting to be done.

The Finished surface of the Paver Block shall have reasonably good plain finish. Paver blocks shall be compacted and shall be

re-laid if necessary. Gravel or such type of materials shall not be allowed for production. Laying on 5 Cms thick sand bedding.

Therate shallbefor aunitofSMT

Paver Block Providing and laying shot blasted Non - interlocking, Paver blocks of specified thickness, size, grade of

concrete and colour machine made and blasting by automatic shot blasting machine and high density of as per

approved sample of approved make for footpath, parking areas, service lanes,cross over and other areas as mentioned in the

drawing. Including providing and laying 50 mm thick averave bedding layer of coarse sand below paver block as per required

grading and specification. Laid paver block shall be mechanically compacted. The work of the paving blocks shall be executed in

line and level by skilled mason of flooring work only. Small size of paver block with same specification shall be used at residue

or at end. It should be laid in such a way that the no cutting of the paver block to be necessary. If cutting of paver block shall be

required , than cut by machine only and laying to be done by skilled flooring mason. The finished surface of the paver

block shall have coarse sand Texture Finish. Pave blocks shall be compacted and shall be re-laid if necessary. Actual laid area

shall be measured and

paid without any wastage. (A) 60 mm thick M-35 grade Grey

Therate shallbefor aunitofSMT

Providing and laying shot blasted Non - interlocking, Paver blocks of specified thickness, size, grade of concrete and

colourmachine made and blasting by automatic shot blasting machine and high density of as per approved sample of

makeforfootpath,parkingareas,servicelanes,crossoverandotherareasasmentionedinthedrawing.Includingprovidingand

laying 50 mm thick averave bedding layer of coarse sand below paver block as per required grading and specification.

Laidpaver block shall be mechanically compacted. The work of the paving blocks shall be executed in line and level by

skilledmason of flooring work only. Small size of paver block with same specification shall be used at residue or at end. It

should belaidinsuchawaythatthenocuttingofthepaverblocktobenecessary.Ifcuttingofpaverblockshallberequired,thancutby

machine only and layingto be done by skilled flooring mason. Thefinished surface of the paver blockshall have coarsesand

Texture Finish. Pave blocks shall be compacted and shall be re-laid if necessary. Actual laid area shall be measured andpaid

without anywastage. (A) 80mmthickM-35grade Grey Paver block ofsize200mmx200mm.

Thescope ofwork:It includessupplying andlaying ofPrecastshot blastedbyautomaticshot blasting

machineinfactory(noton site)paver blocksatfootpath, parking area, servicelaneand other areas.

Theworkincludes:

Paverblock shouldbelaidoverpreparedsubgrade.

Clearingthesitebyremovingallobstaclessuchasstones,debrisetc.forlayingofpaverblocks.

Manufacturingofpaverblocksbyoneoftheapprovedsuppliersasperrequirementsintechnicalspecificationenclosed.

Supplying ofpaverblocks atsite,including handlingatbothends.Thetype ofpaverblockmaybe interlocking ornon-

Providingandlayingaverage50mmcoarsesandbeddingforlayingblocks.

Layingofpaverblocksatsiteasperrequirementintechnicalspecification,withinshortestpossibletime.

Testing of paver blocks through reputed Govt. /Non Govt. Test house and submission of test results as per

inTechnicalSpecifications.Clientreservestherighttocarryouttestatrandom.Costforsuchteststobebornebycontractor.

The contractor shall guarantee that all material and components designed, fabricated, supplied and laid by him

freefromanytypeofdefectduetofaultymaterialand/orworkmanship/erectionforaperiodoffiveyearfromthedateofcomp

letionofwork atindividualsites.However,thecontractorforfiveyearsshallrenderfree maintenance.

TechnicalSpecifications:

PaverBlockManufacturingFacilities:

ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:

ConcreteBlockmakingMachines:

The machine should be capable of producing high quality Paver Blocks by obtaining high level of compaction by application

ofhydraulic compaction and also by high intensityvibration to the moulds. The machine should have automatic control panel

foruniformity instrength.

Concrete Batching & Mixing Plant: (Not essential) The concrete Mix Design should be followed for each batch of materials.

Theconcrete ingredient should be mixed in concrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The

plantshould be equipped with automatic control panel for maintainingwater cement ratio from batch to batch to obtain concrete

ofuniformqualityandstrength.

The plant should be equipped with adequate mechanism for mechanized loading of raw materials into mixer and conveyor

beltfortransportation ofconcretefrommixertoconcreteblockmakingmachineto maintainquality ofwet cement.

Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.Steamcuringfacilityofthepaverblocksisprefera

Laboratory(Desirablebutnotessential):

Thefactoryshouldhavethefollowing:

Compressiontestingmachineofadequatecapacity.

Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.

(1) Systematicrecordoftestresultsofvariouspaverblocksmanufacturedinthefactory.

(2) ConcreteMixDesignforvariousgradeofconcreteusedformakingofpaverblocks.

SpecificationsforColouredPaverBlocks:

ColourconcretepaverblocksshallbemanufacturedasperattachedspecificationsusingapprovedcolourPigmentofironoxideof

approved brand like Bayer, Tata etc. with minimum colour pigment of 3% by weight of cement. The colour shade shall be

asselected by Architect before commencement of the work. The job also includes providing 50 mm thick sand bedding to match

theshadeofthe paverblock.

The colour of the paver block shall be guaranteed against fading of colour for period of 12 months from the date of laying of

Allothertechnicalspecifications&Procedurefortesting,laying&samplingofColorpaverswillbeasperattachment.

PaverBlockCharacteristics:

Theconcretepaversshouldhaveperpendicularitiesafterreleasefromthemouldandthesameshouldberetaineduntilthelaying.

Thesurfaceshouldbereasonablysmoothandofantiskidandantiglaretype.Thepavershouldhaveuniformchamferstofacilitateeasydraina

ge surfacerunoff.

Thepaversshouldhaveuniform interlockingspaceof2mmto3mmtoensurecompactedsandfillingafter vibrationonthepaverSurface.

Theconcretemixdesignshouldbefollowedforeachbatchofmaterialsseparatelyandautomaticbatchingplantistobeusedtoachieveunifor

mityin strengthandquality.

Thepavers shallbemanufacturedinDoublelayeronly.

Skilledlabourshouldbeemployedforlayingblockstoensurelineandleveloflaying,desiredshapeofthesurfaceandadequatecompaction

ofthe sand inthejoints.

PaverBlockDimensions:

Layers Doublelayered,toplayerminimum8to10mm

Irregular(UniformShapewithnoHollowOrCracks)/asperdrawingCham

fer 4mmto6mmalong top edges

Colour NaturalcementgreyColour

withoutuseofanypigment.ForColourpaversrefer“specifica

tionsforColourpavers”

Dimensional (+/-) 2mm for length &

width,Tolerance (+/-)3mmforHeight(Thickness)

TestingofPaverBlocks:

* Samplingandtestingprocedureasperenclosedspecifications

Sampling&TestingProceduresforPaverBlocks:

INTERNAL – Average of minimum 3 samples per 10000 Blocks for compressive strength and water

absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.

SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppendix-A.

CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAppendix-

B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper thickness.

AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).

FlexuralStrength:Testingfor flexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).

WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry Units).

Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks, shall

bedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal testing and

forexternaltesting.

Marking andidentification:All samplesshall beclearlymarkedat thetime of sampling insucha waythat thedesignatedsections of

part thereof, and the consignment represented by the sample, are clearly defined.The sample shall be dispatched tothe

approved test laboratory taking precaution to avoid damage to the paving in transit. Protect the paving from damage

andcontamination until they have been tested. The testing shall be carried as soon as possible, after the sample has been taken.

Assoonaspracticableaftersampling.Thesamplesshallbestored inwaterat 20degree Cfor24hourspriorto testing.

SR.NO. *TEST SPECIFICATIONAverageValues

(AverageofMinimumFiveSamples/Site)

1. CompressiveStrength Min.30N/Sq.mmfor60mmthickandMin.40N/Sq.mm

2. FlexuralStrength Minimum3.80N/Sq.mmand4.5N/Sq.mmfor60and80

mmthickpaverblockrespectively.

3. AbrasionResistance Maximum1.5

4. WaterAbsorption Maximum5.80%

5. MinimumCementContent 380Kg/CumforM 30 concreteand430Kg/CumforM40concrete

Sampling&TestingProceduresforPaverBlocks:

INTERNAL – Average of minimum 3 samples per 10000 Blocks for compressive strength and water

absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.

SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppendix-A.

CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAppendix-

B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper thickness.

AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).

FlexuralStrength:TestingforflexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).

WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry Units).

Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks, shall

bedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal testing and

forexternaltesting.

Marking andidentification:All samplesshall beclearlymarkedat thetime of sampling insucha waythat thedesignatedsectionsofpart

thereof, andtheconsignment representedbythesample, areclearlydefined.

The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving in

transit.Protect the paving from damage and contamination until they have been tested. The testing shall be carried as soon as

possible,afterthesamplehasbeentaken.Assoonaspracticableaftersampling.Thesamplesshallbestoredinwaterat20degreeC5degre

eC for 24hoursprior totesting.

TestForCompressiveStrength:

Testing Machine: The testing machine shall be of suitable capacity for the test and capable of applying the load of the

ratespecified.It shallcomply, asregardsrepeatabilityand accuracy,with therequirementsofclause2.1ofBS:1881-Part4.

Procedure: The sample specimen shall be tested in a wet condition after being stored for at least 24 hours in water maintained

atatemperatureof20 C+or–5 C.Beforethespecimensaresubmergedinwater,thenecessaryareashallbedetermined.

The plates for testing machines shall be wiped clean and any loose grit or other material removed from the contact faces of

thespecimen. Plywood, nominally 4 mm thick shall be used as packing between the upper and lower faces of the specimen and

themachineplatesand theseboardsshallbelargerthanthespecimen by the margin ofat least5mm

atallpoints.FreshPackingshallbeusedforevery specimentested.

Thespecimenshallbeplacedinthemachinewiththewearingsurfaceinthehorizontalplaneandinsuchawaythattheaxesofthespecimenare

alignedwiththose ofthemachine plates.

Theloadshallbeappliedwithoutshockandincreasedcontinuouslyattherateofapproximately15N/Sq.mmperminuteuntilno greaterload

can be sustained.Themaximumload appliedto thespecimen shallbe recorded.

CalculationofcorrectedstrengthforindividualBlocks:Thecompressivestrengthofeachblockspecimenshallbecalculatedbydividingthe

maximumloadby fullcrosssection area oftheblock andmultiplyingwith anappropriatefactorof:-

a) For100mmthickblocks–

b) For80mmthickblocks–1.18

c) For60mmthickblocks –1.06

CompressiveStrengthCalculation:Theaveragecorrectedcompressivestrengthforthedesignedblocksectionshallbecalculated.

4.0Methodoflaying:

Blocksshallbeplacedonthesandbeddingetc.whichwerewellrammedsoastoactasfirmbed.Blocksshallbelaidinsuchmannerthatnogapsh

allbeleftinbetween.Blockssolaidshallbecompactedbymeansofmechanicalcompactororequivalent

compacting method so as to obtain required finished surface. All the joints shall be matched and if any manufacturing defect

isdetectedthelotshallbereplacedandrelayingshallbedonewithoutanyextracostuptosatisfactionofEngineerincharge.

50 to 80mm thick coarse sand shall be laid as cushioning layer for arranging the paver blocks. Joints of the paver blocks shall

befilled withthe sand.

The paver blocks shall be laid properly on the prepared sub-base as per manufacturer's specification and as per Architect

andEngineer-in-charge'sinstruction.

Paver block shall be laid by the approved agency only. If manufacturer of the paver block providing the laying services, then

itshall be laid through the supplying agency only. The labourers for paver block fixing shall be skilled flooring mason only.

Onlycutting tool shall be used for cutting the paver block. Full depth cutting toll shall be used for proper finished surface after

cutting.Manualcutting orbreaking ofthe paver block isnot permitted.

After laying of the paver block fine sand shall be spread over it and paver block shall be compacted with mechanical

compactor.Any settlement or undulationinthelaid areashallbe repaired immediately.

ModeofMeasurementand payment:

Measurementshallbedoneasperactualarealaidwithoutconsideringanywastage.

TheMeasurementoftheitem shallbeinSqmtbasis.

Labour work of fixing kurb any design of central verge, (both side) footpath kurb, items includes necessary excavation,

asphaltcutting of any thickness, erecting in line and position and pointing with cement mortar (1:3), watering, etc complete,

fillingwithzarialongthesideofthekurb,thekurbstonefixpreparedwithbitumnioustopsurface,asdirectedbyengineerincharge.

Work shall be carried out as per item description including cost of all labour and materials etc. complete as

directed.General standardpracticeof layingof paverblockis applicable.

ThemeasurementsshallbeonRMT basis.

Providing and laying cement concrete 1:5:10 (1- Cement : 5- fine sand : 10- graded brick bat aggregates 40mm nominal

size)and curingcomplete.

Before starting the concrete the bed of the foundations trenches shall be cleared of all loose materials and watered and

rammedas directed. The proportion of cement, sand and hand broken stone aggregates shall be one part of cement, 5 parts of

coarsesand, 10parts of hand broken stone aggregates and shall so measured by volume. The concrete shall be mixed in a

mechanicalmixer at the site of work. Hand mixing may however be allowed for smaller quantity of work if approved by the

Engineer-incharge.WhenhandmixingispermittedbytheEngineer-

inchargeincaseofbreakdownofmachinery’sandintheinterestofthe work. itshall be carriedout on a water tight platform and care

shall be taken to ensure that mixing is continued until themass is uniform in colour and consistency. The quantity of water

shall be sufficient to produce a dense concrete of requiredworkability for the purpose. The concrete shall be handled from the

place of mixing to the final position in not more than 15minutes by the method as directed and shall be placed into its final

position, compacted and finished within 30 minutes of mixingwith water i.e. before the setting commences. The concrete shall

be laid in layers of 15 cms. to 20 cms. The concrete shall berammed with heavy iron rammers and rapidly to get the required

compaction and to allow all the gaps to be filled with mortar.After the final set, the concrete shall be kept continuously wet, if

required by pounding for a period of not less than 7 days fromthe date of placement The concrete shall be measured for its

length breadth and depth, limiting dimensions to those specified onplan or asdirected.

ModeofmeasurementsshallbeonCMTbasis

ProvidingTMTBarFE500DreinforcementforR.C.C.Workincludingbending,bindingandplacinginpositioncompleteuptofloortwolevel.

ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.

Modeofmeasurementsshall beonKgbasis.

ProvidingandCastinginsituordinarycement concrete M200 for R.C.C. Raftand cutt off walls including necessaryshutteringlaying,

vibrating,ramming andcuring complete.(B)Walls, fomtopof foundationlevel uptofloortwolevel(upto10ton).

ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.

Modeofmeasurementsshall beonCMTbasis.

Providing and setting 50 to 60 mm thick rouge kotah stone water table in line, level and in required gradient including

mm thick beddcingin C.M. 1:6 (1 Part of cement : 6 Part of coarse sand) with sufficient ramming consolidation. Providing

joints in C.M. 1:3 (1 Part of cement : 3 Part coarse sand) and smooth pointing inC.M. 1:1 (1 Part of Cement, 1 Part of coarse sand)

including watering etc. complete and as per details in tender specification & as directed by engineer in charge.

Size : 1' x 1'(40 to 50 mm thick)

Modeofmeasurementsshall beon RMTbasis.

Labour work for fixing any kind of paving with cementpointing in CM 1:2, including watering, ramming etc comp. as directed

Laying on Sand bedding as per requirement to fix theC.C.Block / Nibhada Stone in Line & Level.

Modeofmeasurementsshall beon SMTbasis.

For Water Table & Kerb on Sand bedding as per requirement to fix the C.C.Block / Nibhada Stone in Line & Level.

Modeofmeasurementsshall beon RMTbasis.

Construction of RCC nosing in central verge using M-200 grade cement concrete. The item includes cost of centering &

shuttering, reinforcement, both side cement plaster in C:M 1:3 mortar & curing etc. complete. Half round portion of the

nosing shall be made by using mild steel.

Modeofmeasurementsshall beon NO.basis.

Providing and laying in position Ready Mixed M-200 grade concrete for reinforced cement conctere work, using cement content

as per approved Design Mix manufactured in fully automatic batching plant and transported to site of work intransit mixer for a

lead up to 10 kms having continuous agitated mixer, manufactured as per mix design of specified grade for reinforced cement

concrete work including pumping of R.M.C. from transit mixer to site of laying, excluding the cost of centering shuttering finishing

and reinforcement including cost of admixtures in recommended proportions as per IS:9103 to accelerate/ retard setting of

concrete, improve work ability without impairing strength and durability as per direction of theEngineer-in-charge. Without Fly

Ash (Min cement level as per latest IS456 shall be maintained) (Cement level 400 kg )

Modeofmeasurementsshall beon CMT.basis.

Provdg. Form work of ordinary timber planking so as to give a rough finish incl. centering, shuttering, strutting and propping etc.

height of propping and centering below supporting floor to ceiling not exceeding 4 M & removal of the same for in situ reinforced

concrete and plain concrete work in

Modeofmeasurementsshall beon SMT.basis.

P/A Trimix with dewatering machine and floater machine on constructed RCC work incl.cost of machine and labour etc comp as

Modeofmeasurementsshall beon SMT.basis.

Making 15 mm groove in RCC work on road and filling it with polysulfied selant and finished it good incl.all labour charges etc

comp as directed.

Modeofmeasurementsshall beon RMT.basis.

Hiring of tractor with trolley considering 8 Hrs. as working day hours incl.Driver

Modeofmeasurementsshall beon DAY.basis.

Providing chota hathi or driver with fuel , to carry out different works during day/night for 8 hrs. shift. Work shall be carried out

as per the instructions of Engineer in charge 4 Nos of labour all necessary permit etc. comp. (For 8 hours shift )

Modeofmeasurementsshall beon SHIFT.basis.

Providing & Supplying JCB Machine on rental basis in case of emergency situation and break down type work & also during

unavoidable condition as per instruction of engg.incharge, rate includes all nece. shifting, fuel and operating charges and stacking

of useful & non-useful materials separately up to store. (No payment should be allowed for non working condition of machinery

and for pipe line excavation and laying work) (Based on Previously approved rate by CE sir )

Modeofmeasurementsshall beon HOUR.basis.

Supplying Pneumatic Breaker Machine for RCC Slab or Asphalt Demolishing Work on site by using Operator, fuel, power Supply

etc. Complete as Directed. (No payment should be allowed for non working condition of machinery and for pipe line excavation

and M.H. work. Allowed only for break down work) (Based on Previously approved rate by C E sir )

Modeofmeasurementsshall beon HOUR.basis.

Repairing damaged M.H. and rasing M.H. up to road level incl. removing damaged brick work and repairing by brick masonry in

C.M. 1:5 and plaster in C.M. 1:3 and fixing C.I. steps and existing MH sheet cover, removing the debris from MH and carting the

same as directed.

Modeofmeasurementsshall beonNOS.basis.

Repairing damaged I.C./ Raising removing damaged brick work and repairing by brick masonry in C.M. 1:5 and plaster in C.M.

1:3 and fixing C.I. steps and existing chamber sheet cover, removing the debris from chamber and carting the same as directed.

Modeofmeasurementsshall beonNOS.basis.

Providing F.R.C. MH seat cover incl. carting to the work site etc. comp. Directed.

A. F.R.C. Extra Heavy Duty (EHD-35) Manhole Covers & Frames Cover : 728mm ø & 100 mm thick circular cover, 35.00 MT

load design, 100x2mm MS flat allround, 16mm ø plain round bar for lifting the cover & should be fitted with plastic cups.

Frame : 560 mm ø clear opening, outer size- 888x888x175 mm. On the upper periphery of frame 25 x 3 mm wide MS flat

should be well embed in concrete to protect the edges of frame. FRC E.H.D.-35 manhole cover & frame described as above

B. F.R.C. Heavy Duty [HD-20] Machinehole Covers - 560 mm ø clear opening, The dimension of frame and cover as per

mentioned in Amend No.1 to IS 12592 : 2002 table

C. F.R.C. Medium Duty [MD-10] Machinehole Covers - 560mm ø clear opening, The dimension of frame and cover as per

mentioned in Amend No.1 to IS 12592 : 2002 table 1..

D. F.R.C. Medium Duty [MD-10] Chamber Covers & Frame- 600 x 450 mm clear opening, The dimension of frame and cover as

per mentioned in Amend No.1 to IS 12592 : 2002 table

E. F.R.C. Light Duty [LD-2.5] Machinehole Covers & Frames-560mm ø clear opening, The dimension of frame and cover as per

mentioned in Amend No.1 to IS 12592 : 2002 table

Modeofmeasurementsshall beonNOS.basis.

Carting and Fixing M.H., Chamber or Catchpite Seat and Cover in line and level to match exisisting road level in C.C. 1:2:4 and

finishing smooth, watering and protecting for 7 days etc. complete as directed. M.H. seat cover will be supplied byA.M.C.(from

Modeofmeasurementsshall beonNOS.basis.

Supplying, labour for break down repairing work for activities like excavation, disliting, removing debris from trench back filling

etc. comp. as directed by Eng.in charge.

Modeofmeasurementsshall beonNOS.basis.

Constructing Bombay Pattern Type Catch Pit of size 0.60 x 0.60 depth up to 1 mt including excavation, B.B.C.C. (1:5:10), 23 cms

thick brick maso. wall in the prop. of CM (1:6) with 40 mm thick IPS flooring in the prop M15 at bottom and 15 mm thick cement

plaster inside the catch pit in the proportion of CM (1:3) with out jali etc. comp. as directed.

Modeofmeasurementsshall beonNOS.basis.

CatchPit Jali (Heavy duty) Fixing P/F FRC catch pit jali with frame 600mm x 600mm clear opening etc. comp.. As directed by

engineer in charge.

Modeofmeasurementsshall beonNOS.basis.

Providing, laying, spreading and compacting graded stone aggregate to wet mix macadam specification including premixing the

Material with water at OMC in mechanical mix plant carriage of mixed Material by tipper to site, laying in uniform layers in sub-

base / base course on well prepared surface and compacting with vibratory roller to achieve the desired density as per Codal

Production & Supply of WMM to site of

worksLayingof WMM

This work shall consist of laying and compacting clean, crushed, graded aggregate and granular material, premixed with water,

toa dense mass on a prepared sub-grade/sub- base/ base or existing pavement as the case may be in accordance with

therequirements of these Specifications. The material shall be laid in one or more layers as necessary to lines, grades and cross-

sectionsshownon the approved drawingsorasdirected bytheEngineer.

The thickness of a single compacted Wet Mix Macadam layer shall not be less than 75 mm. When vibrating or other

approvedtypes of compacting equipment are used, the compacteddepth of a single layer of the sub-base coursemay be upto

mmwith the approval ofthe Engineer.

PhysicalRequirements

Coarseaggregatesshallbecrushedstone.TheaggregatesshallconformtothephysicalrequirementssetforthinTable19-1.

Sevaliya/Timba/Ankodiyaspecialaggregateisonlyacceptable.

Ifthewaterabsorptionvalueofthecoarseaggregateisgreaterthan2percent,thesoundnesstestshallbecarriedoutonthematerialdelivered

to site asperIS:2386 (Part-5).

Table19-1:PhysicalRequirementsofCoarseAggregatesforWetMixMacadamforSub-base/BaseCourses

S.No. Test TestMethod Requirements

1. LosAngelesAbrasionvalueorA IS:2386(Part-4) 40percent(Max.)

ggregateImpact value

IS:2386(Part- 30percent(Max.)

2. CombinedFlakinessandElongationindices(To IS:2386(Part-1) 35percent(Max.)*

* To determine this combined proportion, the flaky stone from a representative sample should first beseparated out. Flakiness index is weight of flakystone

metal divided by weight of stone sample. Only the elongated particles be separated out from the remaining (non-flaky) stone metal. Elongation index

isweightofelongatedparticlesdividedbytotalnon-flakyparticles.Thevaluesofflakinessindexandelongationindexsofoundareaddedup

GradingRequirements

TheaggregatesshallconformtothegradinggiveninTable19-2.

Table19-2:GradingRequirementsofAggregatesforWetMixMacadam

ISSieveDesignation PercentbyweightpassingtheISSieve

Materialfinerthan425 micronshallhavePlasticityIndex(PI)notexceeding6.

The final gradation approved within these limits shall be graded from coarse to fine and shall not vary from the low limit on

onesievetothehighlimit ontheadjacentsieve orviceversa.

Construction Operations:-

Preparation ofBase

The surface of the sub-grade/sub-base/base toreceive the Wetmixmacadam courseshall be preparedtothe specifiedgradeand

camber and cleaned of dust, dirt and other extraneous material. Any ruts or soft yielding places shall be corrected in anapproved

manner and rolleduntil firmsurface isobtained.

Where the Wet mix macadam is to be laid on an existing metalled road, damaged area including depressions and potholes

shallbe repaired and made good with the suitable material. The existing surface shall be scarified and re-shaped to the required

gradeand camberbeforespreadingthe coarseaggregate forWetmixmacadam.

PreparationofMix

WetMixMacadamshouldbepreparedinanapprovedmixingplantofsuitablecapacityhavingprovisionforcontrolledadditionof water

and forced/positive mixing arrangement like pugmill or pan type mixer of concrete batching plant.For small quantity ofwet

mixwork,theEngineermay permitthemixingtobedone in concrete mixers.

Quantityof watershouldnotvaryfrom OMC determinedas perIS : 2720 (partVIII)bymore thanagreedlimit.The mixedmaterialshould

be uniformly wetand nosegregation should be permitted.

Immediately after mixing, the aggregates shall be spread uniformly and evenly upon the prepared subgrade/sub-base/base

inrequired quantities. In no case should these be dumped in heaps directly on the area where these are to be laid nor shall

theirhaulingover a partlycompleted stretchbe permitted.

The mix may be spread either by a paver finisher or motor grader or as per instruction of Engineer-in-Charge and/or

hisauthorized representative. For portions where mechanical means cannot be used, manual means as approved by the

Engineershall be used.The motor grader shall be capable of spreading the material uniformly all over the surface. Its blade shall

havehydrauliccontrolsuitableforinitialadjustmentsandmaintainingthesame soasto achievethespecifiedslopeand grade.

Thepaver finishershallbeself-propelled,havingthefollowingfeatures:

(i) Loadinghoppersandsuitabledistributionmechanism

screedshallhavetampingandvibratingarrangementforinitialcompactiontothelayerasitisspreadwithoutruttingorotherwisemarringth

e surface profile.

(iii) Thepavershallbeequippedwithnecessarycontrol mechanismsoas toensurethatthefinishedsurfaceisfreefrom surfaceblemishes.

The surface of the aggregate shall be carefullycheckedwithtemplates andall high or low sports remediedbyremoving oradding

aggregate as may be required. The layer may be tested by depth blocks during construction. No segregation of layer

andfineparticlesshouldbeallowed.Theaggregatesasspreadshouldbeofuniformgradationwithnopocketsoffinematerials.

Afterthemixhasbeenlaidtotherequiredthickness,gradeandcrossfall/camberthesameshallbeuniformlycompacted,tothefulldepthwith

suitableroller.Ifthethicknessofsinglecompactedlayerdoesnotexceed100mm,smoothwheelrollerof80to

100 kN weight may be used. For a compacted single layer upto 200 mm, the compaction shall be done with the help of

vibratoryrollerofminimum staticweightof80to100kNorequivalentcapacityroller.Thespeedoftherollershallnotexceed5km/h.

In portions having unidirectional cross fall/superelevation, rolling shall commence from the lower edge and progress

graduallytowards the upper edge. Thereafter, roller should progress parallel to the centre line of the road, uniformly over-lapping

eachpreceding trackbyatleastone thirdwidthuntil theentire surfacehas beenrolled.Alternate trips of the rollershallbeterminated

instopsatleast 1m away from any preceding stop.

In portions in camber, rolling should begin at the edge with the roller running forward and backward until the edges have

beenfirmly compacted. The roller shall then progress gradually towards the centre parallel to the centre line of the road

uniformlyoverlappingeach oftheprecedingtrack by at least one-third width untiltheentiresurfacehasbeen rolled.

Any displacement occurring as a result of reversing of the direction of a roller or from any other cause shall be corrected at

onceasspecifiedand/or removedandmade good.

Along forms, kerbs, walls or other places not accessible to the roller, the mixture shall be thoroughly compacted with

mechanicaltampers or a plate compactor. Skin patching of an area without scarifying the surface to permit proper bonding of the

addedmaterialshall notbepermitted.

Rolling should not be done when the subgrade is soft or yielding or when it causes a wave-like motion in the sub-

base/basecourse or subgrade. If irregularities develop during rolling which exceed 12 mm when tested with a 3 metre straight

edge, thesurface should be loosened and premixed material added or removed as required before rolling again so as to achieve a

uniformsurfaceconformingtothedesiredgradeandcrossfall.Innocaseshouldtheuseofunmixedmaterialbepermittedtomakeupthe

depressions.Rolling shall be continued till the density achieved is at least 98 per cent of the maximum dry density for

thematerialasdetermined by the method outlinedin IS :2720(Part-8).

Aftercompletion,thesurfaceofanyfinishedlayershallbewell-closed,freefrommovementundercompactionequipmentorany

compaction planes, ridges, cracks and loose material. All loose, segregated or otherwise defective areas shall be made goodto

the fullthicknessofthelayer andrecompacted.

Settinganddrying:

Afterfinalcompactionofwet mixmacadamcourse,theroadshallbeallowedtodryfor24hours.

OpeningtoTraffic

Preferably no vehicular traffic of any kind should be allowed on the finished wet mix macadam surface till it has dried and

thewearingcourse laid.

Surface Finish and Quality Control of

WorkSurface evenness:

ThesurfacefinishofconstructionshallconformtotherequirementsofClauseinItemNo.16&17&18.

Qualitycontrol:

ControlonthequalityofmaterialsandworksshallbeexercisedbytheEngineerasperTable19-3.

Table19-3:TestandFrequencyforMaterialsforWetMixMacadam

Type Test Frequency ISCode

ofConstructi (Asper CircularNo.66)

Wet Gradation Onetestper200Cu.m. IS:2386,Part-I-1963

MixMacada AggregateImpactValue Onetestper1000Cu.m. IS:2386,Part-IV

Combined Flakiness Onetestper500Cu.m. IS:2386,Part-I

andElongationIndices

Atterberg Limits of portion Onetestper200Cu.m. IS:2720,Part-V

ofaggregatespassing

Densityofcompactedlayer Onesetofthreetestsper IS:2720,Part-VIII

RectificationofSurfaceIrregularity

Where the surface irregularity of the wet mix macadam course exceeds the permissible tolerances or where the course

isotherwise defective due to subgrade soil getting mixed with the aggregates, the full thickness of the layer shall be scarified

overthe affected area, reshaped with added premixed material or removed and replaced with fresh premixed material as

applicableand recompacted. The area treated in the aforesaid manner shall not be less than 5 m long and 2 m wide. In no case

shalldepressionsbefilledup withunmixed andungraded materialor fines.

ArrangementforTraffic

Duringtheperiodofconstruction,arrangementsforthetrafficshallbeprovided.TheContractorshalltakeallnecessarymeasures for the

safety of traffic during construction and provide, erect and maintain such barricades, including signs, marking,flags, lightsand

flagmenasper instruction oftheEngineer-in-charge.

MeasurementsforPayment

Therateshallbe foraunit ofonecubic meter.

Dismantling the following including loading, unloading and disposal of unserviceable material for all lead or as directed by

Engineer-In-Charge and stacking the serviceable material and backfilling the resulting trenches and pits complete.

(Based on Previously approved rate by CE sir )

A. central verge -kerb stone

B. Dismantling tiled or stone floors laid in mortar including stacking of serviceable material and disposal of uservicalble

material with all lead and lifts

Therateshallbe foraunit ofRMT/SMT BASIS.

Applying priming coat over new steel and any other surface after and including preparing the surface by throughly cleaning,

oil,grease, dirt and other foreign matter and scoured with brushes fine steel wood, scrapers and sand paper with ready mixed

priming paint brushing red lead.

Therateshallbe foraunit of SMT BASIS.

Painting one coats (excluding proming coat) on previously painted steel and other metal surface with enamel paint, brushing to

give an even shade including cleaning the surface of all dirt, duct and other foreign matter.

Therateshallbe foraunit of SMT BASIS.

Labour work for fixing interlocking blocks / any kind of pavement on up to 50 mm th sand bedding, levelling, watering and

fixing in line & level as well cleaning the site etc.comp. as directed.

Therateshallbe foraunit of SMT BASIS.

Reinstatement work for Central verge and footpath Kerb Stone

Therateshallbe foraunit ofRMT BASIS.

Painting Two Coats on divider and footpath curb surface / New Concrete Surface ( Painting two coats after filling the surface with

synthetic enamel paint in all shades on new plastered concrete surfaces)

Therateshallbe foraunit of SMT BASIS.

ThecolourandworkmanshipshallbeinaccordancewiththeCodeofPracticeforpainting,andasspecifiedinthedrawingsorasdirected bythe

Materials:SyntheticenamelpaintshallconformtoIS.

The materials required for work of painting work shall be obtained directly from approved manufacturers or approved dealer

andbrought tothesite in maker'sdrums, kegsetc.withseal unbroken.

All materials not in actual use shall be kept properly protected, lids of containers shall be kept closed and surface of paint in

openor partially open containers covered with a thin layer of turpentine to prevent formation of skin. The materials which

havebecome stale or flat due to improper and long storage shall not be used. The paint shall be stirred thoroughly in its

containerbefore pouring into small containers. While applying also the paint shall be continuously stirred in smaller container. No

left overpaint shallbeput back intostocktins.When not in use, thecontainersshallbekept properly closed.

Ifforanyseasons,thinningisnecessary,thebrandofthinnerrecommendedbythemanufacturershallbeused.

The surface to be painted shall be thoroughly cleaned and dusted. All rust, dirt and grease shall be thoroughly removed

beforepainting is started. No painting on exterior or other exposed parts of the work shall be carried out in wet, damp of

otherwiseunfavorableweatherand all thesurfacesshallbe thoroughly dry beforepainting work isstarted.

Brushing operations are to be adjusted to the spreading capacity advised by the manufacture of particular paint. The paint

shallbe applied evenly and smoothly by means of crossing and laying off. The crossing and laying off consists of covering the area

overwith paint, brushing the surface hard for the first time over and then brushing alternately in opposite directions two or

threetimesand thenfinally brushing lightly in directionat rightanglesto the same.

In this process, no brushmarks shallbe left afterthe laying off isfinished. The fullprocess of crossing and laying

offwillconstituteone coat.

Each coat shall be allowed to dry completely and lightly rubbed with very fine grade of sand paper and loose particles brushed

offbefore next coat is applied. Each coat shall vary slightly in shade and shall be got approved from Engineer-in-charge before

nextcoat isstarted.

Each coat except the last cost shall be lightly rubbed down with sand-paper of fine pumice stone and cleaned of dust before

thenext coat is applied. No hair marks from the brush or clogging of paint puddles in the corners of panels angles of mouldings

etc.shallbe lefton the work.

Approvedbestqualitybrushesshallbeused.

Modeofmeasurements&payment:

AnytypeofC.C.Centralvergescurbssurfaceshallbe measuredunderthisitem.

All theworkshall be measurednot inthe decimalsystemas executedsubject to thefollowing limits unless otherwisestatedhereinafter:

(a) dimensionsshallbemeasuredtothenearest0.01metre.

(b) Areasshallbeworkedouttothenearest0.01Sq.metre.

No deductions shallbe madeforopenings not exceeding0.5 sq.mt. eachandnoadditionshallbe madeforpainting

tobeadings,mouldings, edges,jambs, soffits,etc. ofsuchopening.

Thedifferentsurfacesshallbegroupedintoonegeneralitem,areasofunevensurfacebeingconvertedintoequivalentplain

areasinaccordancewiththemode ofmeasurementforpayment.

The rate shall be for a unit of one SMT.

I HAVE ALSO GONE THROUGH TECHNICAL SPECIFICATIONS FOR THE ITEMS (AS PER STANDARD P.W.D. TECHNICAL

SPECIFICATION FOR THE ITEMS AND ALSO I HAVE THE BOOK OF THE SAME) AND AGREE TO ABIDE BY THEM.

IN CASE OF WHERE IS NO TECHNICAL SPECIFICATION FOR THE ANY ITEMS AVAILABLE, SPECIFICATION GIVEN BY THE

ENGINEER-IN-CHARGE SHALL BE FOLLOWED AND FOR THE SAME I AGREE TO ABIDE BY THEM.

SealandSignatureoftheBidder Add.CityEngineer(WestZone)

AmdavadMunicipalCorporation

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

bntldh muJtmœl – œrûtK vrùbÍtul

vrùb Ítul Ítulj ytuVem,

1. Wvhtuf< xuLzhtu su <u Jdobtk btLg hSMx[uNl ^htJ<t ftuLx[tfxh©eytuyu ChJt.

2. xuLzhle rlg< xuLzh Ve <&t R.yub.ze. ck^ fJhbtkk Wvh lt mhltbu ÁcÁ / hSMxh yu.ze./ MvezvtuMx/ fwhegh&e rlg< mbgbtk btufjJtlt hnuNu.

3. ftuLx[tfxh©eytuyu xuLzhle mt&u BGþrlrmvj btLg hSMx[uNlle/ dJobuLx hSMx[uNlle ftuve, (xuLzh ftuve <&t yLg vwhtJt mt&u) yawf mtbuj

fhJtle hnuNu ylu fJh Wvh xuLzh lkch <&t ftuLxufx lkch sYh MvÐ œNtoJJtltu hnuNu.ck^ fhJh Wvh xuLzh ltuxem lkch, xuLzh lkch, ftblwk ltb

<&t, ftuLx[[tfxhle mkM&tlwk ltb <&t ftuLxufx lkch yJ~g œNtoJJtlt hnuNu. ftuLx[tfxhtuyu xuuLzhbt cukfl wltb, Ft<t lkch, btRfh lkch ylu

mhltb wMvÐ yûthtubtk jFJw.

4. xuLzh Ve vu ytuzoh / zebtLz z[tVx&e aqfJJtlehnuNu. œhuf xuLzh œeX yjd xuLzh xuLzhVe ChJtle hnuNu.

5. ytuAe hfble xuLzh Ve, R.yub.ze. fu xuLzh Ve, R.yub.ze. ÂJltlt xuLzhtu hœct<j (fuLmj) dKtNu.

6. xuLzh mt&u BþfJtbtk ytJ<e yluoMxble, xuLzhle hfblt 1% «btKu cukf duhLxe / zebtLz z[tVx / vu ytuzoh / jtufj btRfh auf&e s MJefthJtbtk

ytJNu. œhuf xuLzh œeX yjd R.yub.ze. ChJtle hnuNu. R.yub.ze. hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf,

rzbtLz z[tVx, vu ytuzoh fu cukf duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu R.yub.ze.le hfb btºt rzbtLz z[tVx, vu

ytuzoh fu ckuf duhkxelt MJYvbtk ytvJtle hnuNu.

7. cukf duhuLxe btºt ybœtJtœ Nnuhle s MJefthJtbtk ytJNu.

8. xuLzh Ve <&t R.yub.ze.le hfblt ze.ze./ aufle vtA¤ ftuLx[tfxh©eyu vtu<tle mkM&tlwk ltb <&t btuctRj lkch yJ~g jFJtltu hnuNu. ftuLx[t¾xhu

vtu<tle mkkM&tlt auf <&t ze.ze. xuLzh R~gw &gt <theF ctœlt s ytvJt.

9. Nh<e xuLzhtu hœ ct<j dKtNu.

10. stu xuLzhbtk MvÐ WÕjuF fhtguj ntug <tu atubtmtlu fthKu Ft<tfeg MËalt yLJgu ßgthu ßgthu ftb ck^ htFJtLþk &tg <u mbglu ftble BþÆ<btk bshu

ytvJtbtk ytJNu. vhkðþ yt yLJgu ftuE CtJ J^thtu ytvJtbtk ytJNu lne. sule ltuk^ >huf xuLzhh ujuJe.

11. xuuLzhtu ftuEvK fthK ytÃgt rmJtg MJefthJt fu lrnk MJefthJt <ule mkÃËKo m•tt BGþrlrmvj frbNlh©ele hnuNu.

12. xuLzhbtk stu ftuR mwDtht JDtht ntug <tu <u ykd xuLzh Ch<t vnujt AuÕju ÂœJmu rlg< JucmtRx y&Jt fauheyu sYhe <vtm fhelu s xuLzh btufjJw.

13. mefgtuhexe zevtuÍex/ vVtuboLm duhuLxele hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf, rzbtLz z[tVx, vu ytuzoh fu cukf

duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu mefgtuhexe zevtuÍex/ vhVtuboLm duhkxele hfb btºt rzbtLz z[tVx, vu ytuzoh

fu ckufduhkxelt MJYvbtk ytvJtle hnuNu.

14. ytuljtRl yul-«tufgwh JucmtRx vh&e ChJtlt &<t xuLzhbtk ftuLx[tfxh/ yusLmeyu xuLzhle ntzo ftuvebtk CtJ Cgto Jdhle mne mefft fhe

mcbex fhJtle hnuNu. stu <ubtk CtJ Chuj nNu <tu <uJt xuLzh hœ fhJtbtk ytJNu.

15. dwsht< mhfth ©b,ftuiNÕg ylu htusdth rJCtd îtht XhtJ ¢btf:LED/WRT/e-file/11/2024/0293/M2 mraJtjg ,dtk^eldh

<t.15.02.24 lt XhtJ v{btKu yusLme/¢tuLx[fxhtulu îtht ©bgtude ftgœtle studJtR vhevqKo &tg <u mwrlµ< fhJtlwk hnNu.

16. mœh xuLzhbtk ” GST rl<e rlgb bwsc jtdw vzNu ” <u bwsc dK<he fhe xuLzhtu ChJtlt hnuNu.

zebtLz z[tVx / auf “BgwÂlÂmvj fÂb§h©e, ybœtJtœ” lt ltbltu fZtJJtu.

17. vhevºt 92 <t 20/01/2025 ltu awM< vKu ybj fhJtltu hnuNu.

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

yu.yth.me. xuLzh- Nh<tu

1. yu.yth.me. xuLzhbtk Jfoytuzh ytÃgt ctœ ftb NY fhJtle mbgbgtoœtbtk ftuLx[tfxh îtht ftb NY fhJtle òK fgto ctœ

24 fjtflt ftb NY lrn fhJtbtk ytJu <tu yLg ftuLx[tfxh vtmu btfuox hux&e ftuLx[tfxhlt Faou ylu stuFbu ftbdehe

fhtJJtbtk ytJNu.

2. ftuLx[tfxhlu Jfoytuzoh ytÃgt ctœ yu.yth.me. «fthlkw xuLzh ntuR ftble sYhegt< bwsc xujeVtulef òK fhe su <u ftb NY

fhJt fnuJtbtk ytJNu ylu su ftble òK fgtolt 24 fjtfbtk NY fhJtbtk lrn ytJu ylu rlg< mbgbgtoœtbtk vwKo fhJtbtk

lrn ytJu <tu su <u ytRxblt SOR CtJ&e 1.5 dKe vulÕxe Jmwj juJtbtk ytJNu.

3. ºtK fu J^w Jth Wvh bwscle yLg ftuLx[tfxh vtmu&e ftbdehe fhtJJtle Vhs vzNu ylu/y&Jt ºtK fu J^w Jth vulÕxe

fhJtle Vhs vzNu <tu <u mkstudtubtk ftuLx[tfxhlu çjufjeMx fhJtbtk ytJNu sule ykr<b m•tt Bgw.frb¹lh©elu hnuNu.

AHMEDABAD MUNICLPAL CORPORATION

MAHANAGAR SEVA SADAN

Clause : 1 Contractor shall not employ any child having age 5 to 15 years as it is prohibited by Child Labour Prohibition and Regulation

Act 1986. Hon'ble Supreme Court has given certain guide lines and as per the guide lines. If child labour is employed on the site work,

the contractor shall have to deposit Rs. 20,000.00 (Rupees Tw enty thousand only) in the child labour welfare fund. If the employer

refuses to deposit then action will be taken for contempt of Supreme Court Judgement and also will be prosecuted by concerned

authority. Because of the breach of any provision of child labour prohibition and regulation Act 1986 by the Contractor & Municipal

Corporation becomes liable to pay any amount then the Municipal Corporation shall recover the said amount from the contractor.

Clause : 2 The Standing Committee has decided to deduct 1/2% amount from each running bill as per its Reso. No. 1783 Date 06--02-

97, but the Municipal Corporation Board has recently decided that the actual testing charge is taken and the remaining amount is

refundable at the time of final bill (As per Muni. Board Reso. No. 123 dated 25-02-97)

Clause : 3 Contractor has to follow prevailing Labour act and has to maintain labour register acordingly,and has to follow other

Clause : 4 Quantity taken in tender are tentative and may differ as per execution of work. No claim shall be entertain regarding

* MODIFICATION OF DOCUMENTS

Modification of specifications and correction/corrigendum in respect of the work if required will be made by A.M.C. The same shall

be placed on A.M.C website which may be downloaded by the tendrers enclosed along with the tender duly signed. These shall form

a part of tender. The tenderer shall not add or amend the text of any of the documents except in so far as may be necessary to

comply with any addendum.

* ADDENDAUM/CORRIGENDUM .

Addendum or corrigendum conveying any change or correction in respect of the work shall form the part of the contract documents.

The full consideration shall be given to such addendum or corrigendum or correction before submission tender duly filled in by the

contractor. Therefore, the contractor shall have to watch such addendum or corrigendum or correction published by A.M.C through

its website www.egovamc.com. Tenderes shall verify the number of addendum issued and enclose the same with the tender

documents,failing which the tender shall be liable for rejection and no any complaint in respect to this shall be entertained under any

CONTRACTOR'S SIGNATURE ADDL.CITY ENGINEER

& STAMP ( West Zone)