Loading…
Loading…
Tender Value
₹2.0 Cr
EMD Value
₹2 L
Closing Date
17 Jul 2026, 6:00 pm
Dy.Minicipal Commissioner - West Zone
P/L Foothpath And repairing Foothpath at Diff area And Intrelocking paver block work Under Dy. mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff Budget In Diff Areas Of Ranip ward Of WZ (ARC)
319871
1/26-27 (T.N.4)
Open
Civil Works - Others
Ahmedabad
4 documents required · 0 mandatory · 4 optional
₹3,600
Municipal Commissioner, Ahmedabad
₹2 L
2 Jul 2026
2 Jul 2026
2 Jul 2026
17 Jul 2026
2 Jul 2026
Name of Work :P/L Foothpath And repairing Foothpath at Diff area And Intrelocking paver block work Under Dy.
mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff Budget In Diff Areas Of Ranip ward Of WZ (ARC)
Item Description Qty Rate per Amount
Excavation for foundation upto 1.5 mt. depth including
1 sorting out stacking of useful material & disposing of Cmt
excavated stuff upto 50 mt. lead loose or soft soil.
Dismantling the following including loading, unloading
and disposal of unserviceable material for all lead or as
2 directed by Engineer-In-Charge and stacking the
serviceable material and backfilling the resulting
trenches and pits complete.
a central verge -kerb stone 8.00 Rmt
Dismantling tiled or stone floors laid in mortar including
b stacking of serviceable material and disposal of Smt
uservicalble material with all lead and lifts.
Demolition & disposal of unservisable material with all
lead and lift for unreinforeced concrete. (AMC sor) 500.00 348.10
Demolition of brick work & stone masonry including
stacking of serviceable materials and disposal of
unserviceable materials with all lead and lift (1) In 150.00 314.50
Demolition including stacking of serviceable materials
e and disposal of unserviceable materials with all lead and Cmt
lift. (I) R.C.C work.
Labour Work For Fixing Any Kind Of Paving With
3 Cement Pointing In Cm 1:2, Including Watering,
Ramming Etc Comp. As Dir.For Pavement Sub:-
(A)For Water Table & Kerb On Sand Bedding As Per
(a) Requirement To Fix The C.C.Block / Nibhada Stone In Rmt
(A)Laying On Sand Bedding As Per Requirement To Fix
The C.C.Block / Nibhada Stone In Line & Level 2,500.00 68.64
Providing, laying, spreading and compacting graded
stone aggregate to wet mix macadam specification
including premixing the Material with water at OMC in
mechanical mix plant carriage of mixed Material by
4 tipper to site, laying in uniform layers in subbase / base
course on well prepared surface and compacting with
vibratory roller to achieve the desired density as per
(A) Supply of WMM Cmt
(B) Laying of WMM Cmt
Conveyance charge of earth, lime, murrum,
building rubbish, manure, garbage, sludge,
excavated rock, fly ash, aggregates of any kind
executed outside the road site. Rate also includes
spreading & levelling etc complete. Internal
5 conveyance above 50 mt done within the work
site is not payable. (R&B 2021-22 Statement No.5
Page no.5 & RA Approved St.Com.Res
a) Lead up to 1 Km.
b) Lead From 1Km to 2 Km.
c) Lead From 2 Km to 3 Km.
d) Lead From 3 Km to 4 Km.
e) Lead From 4 Km to 5 Km.
f) Lead From 5 Km to 10 Km.
g) Lead From 10 Km to 15 Km.
Leveling Or Orientation Of Existing Gully Trap Chamber
6 Incl. Nece. Masonry In Cm 1:6 And Plaster In Cm 1:3 Etc. No
Using Old G.T.Stone And Cover Etc. Comp.Sub:-
Repairing damaged M.H. and rasing M.H. up to road
level incl. removing damaged brick work and repairing
7 by brick masonry in C.M. 1:5 and plaster in C.M. 1:3 and
fixing C.I. steps and existing MH sheet cover, removing
the debrisfrom MH and carting the same as directed.
(A) Up to 0.15 mt. (@ Two Coarse) No
(b) up to 0.35mt. (@ Four Coarse) No
(C ) up to 0.65 mt. (@ Seven Coarse) No
Extra Rate Over Item Of Excavation Of Earth For
Excavation Of Asphalt Pavement / Rcc Of Thickness
8 Upto 0.20 Meter Including Demolishing The Asphalt
Carpet,Metal,Soiling/Cutting Reinforcement Etc.Comp.
With Stacking The Material As Directed. Sub:-
(a) A) Upto 0.20 Meter Thickness (By Manual) Smt
B) 0.20 Meter To 0.30 Meter Thickness (By Breaker
(b) Machine Including Cost Of Operator, Fuel, & Smt
Transportaion Etc Complete.
(C) 0.30 Meter & Above (By Breaker Machine Including
Cost Of Operator, Fuel, & Transportaion Etc Complete. 500.00 311.08
Supplying and fixing of 380 mm H x 300 mm L x 200 mm
B Kerb block for Central Verge in M-20 grade using
mm nominal size black trap aggregate of Sevaliya/Timba
or equivalent quality for pre-cast blocks, reasonably
exposed finish/ formwork, mould with well equipped
with vibratory system for kerb stones of approved
design including curing, etc. complete, including the
cost of formwork etc. complete. The rate shall also
include necessary cutting of asphalt, fixing the Kerb
stones in line and level on 5 cm thick sand bedding with 10.00 431.96
necessary equipments and materials. The rate shall also
include the flush pointing in CM (1:3) for all joints of the
kerbstones. Filling of zari alone the sides of the kerb
stone fixed with Bituminous concrete mixed in proper
position as directed by Engineer in change to form a
portable mixture. In any case Gravel or such type of
materials shall not be allowed for productiona) Laying
on 5 cm thick Sand Bedding
Supplying and fixing of 300 mm-L x 150 mm-B x
mm-H Kerb block for Footpath in M-20 grade using
mm nominal size black trap aggregate of Sevaliya/Timba
or equivalent quality for pre-cast blocks, reasonably
exposed finish/ formwork , mould with well equipped
with vibratory system for kerb stones of approved
design including curing, etc. complete, including the
cost of formwork etc. complete. The rate shall also
include necessary cutting of asphalt, fixing the Kerb
stones in line and level on 5 cm thick sand bedding with 4,000.00 350.89
necessary equipments and materials. The rate shall also
include the flush pointing in CM (1:3) for all joints of the
kerbstones. Filling of zari alone the sides of the kerb
stone fixed with Bituminous concrete mixed in proper
position as directed by Engineer in change to form a
portable mixture. In any case Gravel or such type of
materials shall not be allowed for production. a) Laying
on 5 cm thick Sand Bedding
Pre cast concrete kerb Providing and fixing M25 Grade
of concrete precast exposed / Fair finish / texture finish
kerb stones of approved make as per approved sample
of any size and any type. Kerbs shall be fixed on the
foundation prepared as per approved design. The rate
shall also include for erecting and fixing the pieces in
position for complete kerb system with chamfered type
of kerbs including necessary accessories of kerb like
radius kerb, angles and quadrant kerbs, droplet kerbs
etc. complete as per drawing. Kerb shall be fixed as
paper joint without any jointing material. However 350.00 1,061.61
cement mortar shall be provided at the backside of kerb
stone joint. (Sample must be approved) Cost of
excavation, cutting , base , side filling shall includes as
directed engineer - incharge in above item description
as per BOQ (a) 450 hight x 600x 150 mm high median
Pre cast concrete kerb Providing and fixing M25 Grade
of concrete precast exposed / Fair finish / texture finish
kerb stones of approved make as per approved sample
of any size and any type. Kerbs shall be fixed on the
foundation prepared as per approved design. The rate
shall also include for erecting and fixing the pieces in
position for complete kerb system with chamfered type
of kerbs including necessary accessories of kerb like
radius kerbs, angles and quadrant kerbs, droplet kerbs
12 etc. complete as per drawing. Kerb shall be fixed as Rmt
paper joint without any jointing material. However 350.00 912.50
cement mortar shall be provided at the backside of kerb
stone joint. (Sample must be approved) Cost of
excavation, cutting , base , side filling shall includes as
directed engineer - incharge in above item description
as per BOQ (b) 380 x 600 x 150 mm high Footpath kerb.
Providing & laying Mountable type Central Verge
including casting of Kerb of size 15.00 x 32.50 Cm by
mechanical Kerb casting machinery and oil paint colour
to Center verge (Kerb) by Yellow/white and Black patta
13 (Three Coat) one coat of priming & two coat of oil Paint Rmt
including cost of material required for paint and all
labourworketc complete as per direction, detailed
drawing and instruction of engineer incharge .(Including
Epoxy Piant of Approved Quality) (Central Verge)
Supplying and fixing for central verge 230 mm L x
mm Width x 680 mm H Supplying & Fixing in M-20
grade using 20 mm nominal size black trap aggregate of
sevaliya/timba or equivalent quality for pre-cast
blocks,reasonably exposed finish/formwork,mould with
well equipped with vibratory system for kerb stones of
approved design including
curing,etc.complete,including the cost of formwork
etc.complete.THe rate shall also include necessary
cutting of asphalt,fixing the kerb stones in line and level 50.00 1,376.75
on 5 cm thick sand bedding with necessary equipments
and materials.The rate shall also include the flush
pointing in CM(1:3)for all joints of the kerbstones.Filling
of Zari alone the sides of the kerb stone fixed with
bituminous concrete mixed in proper position as
directed by engineer in charge to form a portable
mixture.In any case gravel or such type of materials
shall not be allowed for production.
Providing and Laying of Rubber Moulded Paver Block
Grey/Coloured 60 mm thick, M-35 Grade of any size ;
shape (Usually Uni-Paver Blocks) using black trap good
quality aggragate of 20 mm nominal size for footpath,
parking areas, service lanes and other areas as
mentioned in the drawing / instruction of engineer in
charge. Cost includes formworks using rubber mould,
Rate providing and laying paver blocks as per required
grading and specification. The paver block shall be
mechanically compacted. The work of paving blocks
shall be executed in line and level by skill mason of 6,000.00 501.60
flooring work only. It should be laid in such a way that
the no cutting of the paver block to be necessary. if
cutting of paver block necessary then it should be cut by
machine only and carting. The finished surface of the
paver block shall have resonably good, plain finished.
Paver blocks shall be compacted and shall be relaid if
necessary. Gravel or such type of materials shall not be
allowed for production. Laying on 5cms thick sand
Providing and laying of interlocking grey paver blocks of
high density 80mm thick made from M-40 grade
concrete using 6 mm to 20 mm machine crushed well
graded stone aggregate, sand of approved quality, OPC
53 grade cement with contractor's own concrete mix
design as approved by AMC, for parking, road. Cost
Includes formwork, using rubber/FRP mould, laying
paver block as per required grading and specification
laid paver block shall be mechanically compacted. The
16 work of the paving blocks shall be executed in line and Smt
level by skilled mason of flooring work only. It should be
laid in such a way that the no cutting of the paver block
to be necessary. Cutting of paver block by machine cut
only and carting to be done. The Finished surface of the
Paver Block shall have reasonably good plain finish.
Paver blocks shall be compacted and shall be re-laid if
necessary. Gravel or such type of materials shall not be
allowed for production. Laying on 5 Cms thick sand
Paver Block Providing and laying shot blasted Non -
interlocking, Paver blocks of specified thickness, size,
grade of concrete and colour machine made and
blasting by automatic shot blasting machine and high
density of as per approved sample of approved make
for footpath, parking areas, service lanes,cross over and
other areas as mentioned in the drawing. Including
providing and laying 50 mm thick averave bedding layer
of coarse sand below paver block as per required
grading and specification. Laid paver block shall be
mechanically compacted. The work of the paving blocks
17 shall be executed in line and level by skilled mason of Smt
flooring work only. Small size of paver block with same
specification shall be used at residue or at end. It should
be laid in such a way that the no cutting of the paver
block to be necessary. If cutting of paver block shall be
required , than cut by machine only and laying to be
done by skilled flooring mason. The finished surface of
the paver block shall have coarse sand Texture Finish.
Pave blocks shall be compacted and shall be re-laid if
necessary. Actual laid area shall be measured and paid
without any wastage. (A) 60 mm thick M-35 grade Grey
Paver block of size 200mm x 200mm.
Paver Block Providing and laying shot blasted Non -
interlocking, Paver blocks of specified thickness, size,
grade of concrete and colour machine made and
blasting by automatic shot blasting machine and high
density of as per approved sample of approved make
for footpath, parking areas, service lanes,cross over and
other areas as mentioned in the drawing. Including
providing and laying 50 mm thick averave bedding layer
of coarse sand below paver block as per required
grading and specification. Laid paver block shall be
mechanically compacted. The work of the paving blocks
18 shall be executed in line and level by skilled mason of Smt
flooring work only. Small size of paver block with same
specification shall be used at residue or at end. It should
be laid in such a way that the no cutting of the paver
block to be necessary. If cutting of paver block shall be
required , than cut by machine only and laying to be
done by skilled flooring mason. The finished surface of
the paver block shall have coarse sand Texture Finish.
Pave blocks shall be compacted and shall be re-laid if
necessary. Actual laid area shall be measured and paid
without any wastage. (A) 80 mm thick M-35 grade Grey
Paver block of size 200mm x 200mm.
Labour work of fixing kurb any design of central verge,
(both side) footpath kurb, items includes necessary
excavation, asphalt cutting of any thickness, erecting in
19 line and position and pointing with cement mortar (1:3), Rmt
watering, etc complete, filling with zari along the side of
the kurb, the kurb stone fix prepared with bitumnious
top surface, as directed by engineer in charge.
Provdg. & laying cement concrete 1:5:10 (1 cement :
coarse sand : 10 hand broken stone aggregates 40 mm
nominal size) and curing complete excluding cost of 1,000.00 1,802.24
Providing TMT Bar FE500D reinforcement for R.C.C.
21 Work including bending,binding and placing in position Kg
complete upto floor two level
Providing and Casting in situ ordinary cement
concrete M200 for R.C.C. Raft and cutt off walls
22 including necessary shuttering laying, vibrating, Cmt
ramming and curing complete.(B) Walls, fom top of
foundation level upto floor two level (upto 10ton).
Providing and setting 50 to 60 mm thick rouge kotah
stone water table in line, level and in required gradient
including 25 mm thick beddcing in C.M. 1:6 (1 Part of
cement : 6 Part of coarse sand) with sufficient ramming
23 consolidation. Providing joints in C.M. 1:3 (1 Part of
cement : 3 Part coarse sand) and smooth pointing in
C.M. 1:1 (1 Part of Cement, 1 Part of coarse sand)
including watering etc. complete and as per details in
tender specification & as directed by engineer in charge.
Size : 2'0" x 1'0" (600mm × 300mm) Rmt
Size : 1' x 1'(40 to 50 mm thick) Rmt
Construction of RCC nosing in central verge using M-200
grade cement concrete. The item includes cost of
centering & shuttering, reinforcement, both side
cement plaster in C:M 1:3 mortar & curing etc. 50.00 4,812.72
complete. Half round portion of the nosing shall be
made by using mild steel.
Painting Two Coats on divider and footpath curb surface
/ New Concrete Surface ( Painting two coats after filling
25 the surface with synthetic enamel paint in all shades on Smt
new plastered concrete surfaces) (R & B SOR 2012-13
Item No. 8.8 page-49)
Finishing Wall With Apex Ultima Acrylic Paint Of " Asian
Paint " Or Equivalent On Wall Surfaces (Two Coats) To
Give Required Even Shade After Application Of Exterior
Primer Of Approved Brand & Manufactures After 200.00 64.29
Thoroughly Brushing The Surface To Remove All Dirt &
Remains Of Loose Powered Materials.(
P/F Name Board of 45X60 cm size showing grant detail
27 with necessary painting & writing letters as per given No
inst. & design etc comp.Sub:-
Providing and laying in position Ready Mixed M-200
grade concrete for reinforced cement conctere work
using cement content as per approved Design Mix
manufactured in fully automatic batching plant and
transported to site of work in transit mixer for a lead up
to 10 kms having continuous agitated mixer,
manufactured as per mix design of specified grade for
reinforced cement concrete work including pumping of
R.M.C. from transit mixer to site of laying, excluding the 344.00 3,922.86
cost of centering shuttering finishing and reinforcement
including cost of admixtures in recommended
proportions as per IS: 9103 to accelerate/ retard setting
of concrete, improve workability without impairing
strength and durability as per direction of the Engineer -
in - charge. Without Fly Ash (Min cement level as per
latest IS 456 shall be maintained)
Providing and supplying of labour for necessary manual
29 excavation, cleaning, Shifting of Material Or any other, Each
or for any other work as directed by Engineer In charge.
Labour charges - Mazdoor (Male) -
Providing and fixing Tree Guard with grey exposed finish
in grade M-20 with
nominal steel and wall thickness of 100mm. (Approved
Extra Item Rate)
a Outer Size 700X700 No
b Outer Size 900X900 No
HUME PIPE FOR TREE PITProviding and fixing RCC NP3
class humepipe of 900mm internal dia. and required
length in single piece or two circular half for tree pit
31 shall be placed in excavated pit as per drawing and as No
directed by engineer in charge. Rate shall be inclusive of
material, labour for cutting, excavation, placing in
position etc complete.( Law Garden Rate)
FRP TREE PIT COVER
Providing and fixing solid tree pit cover around the tree
pit, made of FRP of size having approximate 1200mm
outer dia and 750mm inner dia and 40mm thickness
32 with fixing arrangement with base structure of No
approved make and shade, as per design intent
including fixing as per drawing etc. complete as directed
by Engineer in charge. Sample and mock-up shall be
approved by architect before execution. Garden Rate)
Pre cast Cylindrical Bollard Providing, hoisting, and
arranging in position exposed fair finish, factorymade
pre-cast bollard of approximately size 800mm high and
280mm Dia as per design intent, of approved make,
made of minimum M-30 grade reinforced cement
concrete. The rate shall also include for erecting and
fixing the bollard in position as per drawing, curing,
finishing, cost of excavation,base PCC M15 grade and
finish good, rendering (if required), transportation,
loading and unloading charges, etc complete as
directedby Engineer in charge. Precast bollard shall be
with provision with MS Hook & fixing safety chain
between two bollard. Weight of hook and chain shall be 50.00 1,967.02
paid in relevant tender items. Contractor shall submit
methodology for erection of bollard and get approved
from Engineer in charge. Location andtype of each
liffting hook shall be as per design intent and approved
from engineer incharge. Sample shall be approved by
Architect and Engineer incharge before mass
production. Architect reserves right to reject part or
allwork of sub standard or not in confirmation to
approved sample as permock up. Sample and mock
shall not be payble if rejected or casted in otherlocation
(not in scope of work area). ( Law Garden Rate )
Providing and fixing exposed finish bollard having
concrete grade M-20 with nominal steel . The rate shall
also include, Any Shape and Color including in
rate, for erecting and fixing the bollard in position as per
drawing, curing,finishing, cost of excavation, base PCC
M15 grade and finish good,rendering (if required),
transportation, loading and unloading charges,etc
complete as directed by Engineer in charge. Precast
bollard shall be with provision with MS Hook & fixing
safety chain between two bollard.Weight of hook and
chain shall be paid in relevant tender items. Contractor
shall submit methodology for erection of bollard and
get approved from Engineer in charge. Location and
type of each liffting hook shall be as perdesign intent
and approved from engineer incharge. Sample shall be
approved by Architect and Engineer in charge before
mass production.Architect reserves right to reject part
or all work of sub standard or not in confirmation to
approved sample as per mock up. Sample and mock
shall not be payble if rejected or casted in other location
(not in scope of work area).
(Approved Extra Item Rate)
a RCC 300mm dia and 650mm height Cylindrical Bollard No
RCC 900mm height and 250x250mm Bottom and
Road marking with hot applied thermoplastic paints
with reflectorising glass beads on bitumin surface
providing and laying a hot applied thermoplastic
compound 2.5 mm thick including reflectorising glass
beads @ 250gms per sqm area, thickness of 2.5mm is 502.00 510.62
excluding of surface applied glass beds as per IRC:35.
The finished surface to be level, uniform and free from
streaks and holes.) Directional Arrow, Lettering.
Cat Eye / Road Stud / RPM: Supplying of Molded Twin
Shanks Raised Pavement Markers made of
polycarbonate and ABS moulded body and reflective
panels with micro prismatic lens capable of providing
total internal reflection of the light entering the lens
face and shall support a load of 13635 kgs. tested in
accordance to ASTM D 4280 Type H and complying to
Specifications of Category A of MORTH Circular No
RW/NH/33023/10-97 DO III Dt 11.06. 1997. The height,
width and length shall not exceed 20 mm, 130 mm and
36 130 mm and with minimum reflective area of 13 Sqcm NOS.
on each side and the slope to the base shall be 35 +/-
degree. The strength of detachment of the integrated
cylindrical shanks, (of diameter not less than 19 +/-
mm and height not less than 30+/- 2 mm) from the
body is to be a minimum value of 500 Kgf. Fixing will be
by drilling holes on the road for the shanks to go inside,
without nails and using epoxy resin based adhesive as
per manufacturers recommendation and The color of
the marker should be as per the IRC 35- 2015 and as
directed by Engineer-in-charge. SOR RB IT NO:26162A
Painting Two Coats on divider and footpath curb surface
/ New Concrete Surface ( Painting two coats after filling
the surface with synthetic enamel paint in all shades on 100.00 71.86
new plastered concrete surfaces)
Painting lines, deashes, arrows, letters etc on roads, Air
fields and like in two coats with road marking paint,
38 brushing including cleaning the surface of all dirt, dust SMT
and other foreign latter. (i) Over 10cm in width SOR 23-
24 IT CODE: 19025A
Painting lines, deashes, arrows, letters etc on roads, Air
fieldsand like in two coats with road marking paint,
39 brushing including cleaning the surface of all dirt, dust RMT
and other foreign matter. (ii) Upto 10 cm in width SOR
23-24 IT CODE: 19025B
Contractor'sSign Addl.C.E.
MobilNo:- (westzone)
As per account department(A.M.C.) circular no. 10 Dt.05/08/2024 Bank guarantee of said
work must be of Ahmedabad city branch, which mentioned as bellow.
(A) Guarantee issued by following bankswill be accepted as SD/EMD on permanentbasis.
(1) All Nationalized Banks including the Public Sector Bank-IDBI LYF.
(2) Private Sector Banks authorized by RBI to undertake State Government
Business (at present : AXIS Bank, ICICI Bank, HDFC Bank)
(B) Guarantees issued by following Banks will be accepted as SD/EMD for the period up to.
(1) Commercial Banks :
1) A U SMALL FINANCE BANK
3) BANDHAN BANK
4) CITY UNION BANK
6) DBS BANK INDIA LIMITED
8) EQUITAS SMALL FINANCE BANK
9) FEDERAL BANK
15) IDFC FIRST BANK
16) INDUSLND BANK
17) JANA SMALL FINANCE BANK
18) KARNATAKA BANK
19) KARUR VYSYA BANK
20) KOTAK MAHINDRA BANK
21) SOUTH INDIAN BANK
22) TAMILNADU MERCANTILE BANK
23) UTKARSH SMALL FINANCE BANK
(2) Co-Operative Banks of Gujarat
1) The Ahmedabad Mercantile Co –Oparative bank limited
2) Kalupur commercial Co-operative Bank limited
3) Nutan Nagrik Sahakari Bank limited
4) Saraswt Co-operative Bank
5) SVC Co-operative Bank
6) THE Cosmos Co-operative Bank
7) Baroda Gramin Bank
8) Saurashtra Gramin Bank
9) THE Gujarat State Co-operative Bank
10) The Mehsana Urban Co-Operative Bank Ltd.
11) The surat district Co-operative Bank
12) The surat peoples Co-operative Bank
AHMEDABAD MUNICIPAL CORPORATION ENGINEER DEPARTMENT
TECHNICALSPECIFICATION
Nameof Work :- P/L Foothpath And repairing Foothpath at Diff area And Intrelocking paver block work Under Dy.
mayor , Municipal Councilor Shree /MP/ MLA Budget And Diff Budget In Diff Areas Of Ranip ward Of WZ (ARC)
GeneralTechnicalSpecificationSection
FollowingtechnicalspecificationsshallbeapplicabletotherelevantitemsofBOQ
Earth work in cutting in all sorts of soil &murrumincldg.conveyaning ,breakingclods spreadingthe stuffas & where
dire. With in a lead of 50 mt. from end of cutting.
Themodeofpaymentforthisitemshall beon Cmt. Basis.
Conveyance charge of earth, lime, murrum, building rubbish, manure,
garbage, sludge, excavatedrock, flyash, aggregates of any kind Including
spreading & levelling etc. complete.
Themodeofpaymentforthisitemshall beon Cmt. Basis.
Dismantling the following including loading, unloading and disposal of unserviceable material for all lead or as directed
byEngineer-In-Chargeand stackingtheserviceable materialandbackfillingthe resultingtrenchesandpitscomplete.
a. centralverge-kerbstone.
b. Dismantlingtiledorstonefloorslaidinmortarincludingstackingofserviceablematerialanddisposalofunserviceablem
aterialwith all lead andlifts.
c. Demolition&disposalofunserviceablematerialwithallleadandliftforunreinforcedconcrete.
d. Demolitionofbrickwork&stonemasonryincludingstackingofserviceablematerialsanddisposalofunserviceablemat
erialswithalllead andlift(1)In cementmortar.
e. Demolitionincludingstackingofserviceablematerialsanddisposalofunserviceablematerialswithallleadandlift.(I)R.C
Thedemolitionshallconsistofdemolitionofoneormorepartsofthestructureasspecifiedorshowninthedrawings.Demolition implies
taking up or down or breaking up. This shall consist of demolishing whole or part of work including all relevantitemasspecified or
shownin the drawings.
The demolition shall always be planned before hand and shall be done in reverse order of the one in which the structure
wasconstructed.Contractorisfully responsibleforproperandsafedemolition.
Necessary dropping, shoring and under pinning shall be provided for the safety of the adjoining work or property, which is to
beleft intact, before dismantling and demolishing is taken up and the work shall be carried out in such a way that no damages
iscaused tothe adjoiningproperty.
Wherever required, temporary enclosures or partitions shall also be provide 1. Necessary precautions shall be taken to keep
thedust nuisance downasandwhere necessary.
Dismantling shall be commenced in a systematic manner. All materials which are likely to be damaged by dropping from a
heightor demolishing roof, masonry etc. shall be carefully dismantled first. The dismantled articles shall be properly stacked as
directed.All materials obtained from demolition shall be the property of Government unless otherwise d shall be kept in safe
custody untilhanded over totheEngineer-in-charge.
Any serviceable materials, obtained during dismantling or demolition shall be separated out and stacked properly as
directed,withalllead andlift.Allunserviceablematerials, rubbishetc.shallbstacked asdirectedby theEngineer-in-charge.
Oncompletionofwork,thesiteshallbeclearedofalldebrisrubbishandcleanedasdirected.
Modeofmeasurements&payment:
Measurementsofallworkexcepthiddenworkshallbetakenbeforedemolitiondismantlingandnoallowanceforincreaseinbulk shall be
allowed. The demolition of lime concrete shall be measured under this item. Specification for deduction for
voids,openingsetc.shall beonsamebasisasthat employedforconstructionofwork.
All work shall be measured in decimal system as fixed in its place subject to the following limits, unless otherwise
statedhereinafter : (a) Dimensions shall be measured to the nearest 0.01 mt. (b) Area shall be worked out to the nearest 0.01 sq.
mt.(c,d,e)Cubicalconnectionshallbe worked outto the nearest 0.01 Cu.m.
Therateshallincludecostofalllabourinvolvedandtoolsusedindemolishinganddismantlingincludingscaffolding.Therateshall also
include the charges for separating out and stacking the serviceable materials properly and disposing the unserviceablematerials
with all lead and lift. The rate also includes for temporary storing for the safety of the portion not required to be
pulleddownorofadjoiningpropertyandprovidingtemporary enclosuresorpartitions whereconsidered necessary.
The rate shall be for a unit of one cubic
metre.For Dismantlingof Tiled Floor:
The relevant specifications shall be followed except the dismantling of tiled or stone floors laid on mortars shall be
doneDismantling implies carefully taking up or down or these are fixed by nail screws bolts etc. the shall be taken out with
Modeofmeasurement&Payment:
Thesupportingmaterials suchas joints beams if
anyetc.shallbemeasuredseparately.Therateshallincludestackingtheunserviceablematerialsasdirectedwillleadandlift.
Therateshallbeforaunitof(a)RMT(b)one sq.Meter(C) CMT(d)Cu.m(e)Cu.m
Extra rate over item of excavation of earth for excavation of asphaltpavement / RCC of thickness up to 0.20 meter
includingdemolishing the asphalt carpet, metal, soiling/cutting Reinforcement etc. comp. with stacking the material as
directed. (a) upto 0.20 meter thickness (By Manual)(b) 0.20 to 0.30 meter (By any type ofBreaker Machine or R.C.C.Cutter
machine includingcost of operator, fuel, & transportation etccomplete.(c) 0.30 meter & above (By any type of Breaker
Machine or R.C.C.Cuttermachineincludingcostofoperator,fuel,&transportationetc complete.
TheItemshallbecarriedoutasperItemdescriptionandasperinstructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.
Therateincludesthecostofexcavationofbituminousmacadami.e.bituminouslayersonlylikeDBM,BCetcincludingthelabours,tools,equip
mentandallotherincidentalexpenses.NonBituminousSub-layer/Subbasearenotconsideredinthisitem.
WorkshallbecarriedoutmanuallyorbyMachineryaspersiterequirements.Themode
ofpaymentforthisitemshall beon Smt. Basis.
Supplying and fixing of 380 mm H x 300 mm L x 200 mm B Kerb blockfor CentralVerge in M-20 gradeusing 20 mm nominal size
black trap aggregate of Sevaliya/Timba or equivalent qualityfor pre-cast blocks, reasonably exposed finish/ formwork,
mouldwith wellequipped with vibratory system for kerbstones ofapproved designincluding curing, etc. complete, including the
cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level on
cm thick sand bedding with necessaryequipmentsand materials. The rate shall also include theflush pointingin CM (1:3) forall
jointsof thekerbstones. Filling ofzari alonethe sidesof thekerb stonefixed withBituminous concretemixed inproper position
as directed by Engineer in change to form a portable mixture. In any case Gravel or such type of materials shall not be allowed for
productiona) Laying on 5 cm thick Sand Bedding
Thespecifictionoffollowingmaterialsshallbeconformingwithspecificationmentionedforrelaventmaterial/itemsinGeneraltechnicalspe
cification for buildingworkofR&B DepartmentofGujarat.
Water shall conform to M-
Gradedstoneaggregate20 mm.nominal sizetoM-10
Contractor shall have to manufacture the blocks as per the dimensions given in the drawing. Specific machineries shall be used
tomanufacturetheprecastblocks.Thesemachineriesshouldbecompatibletoproduceblocksofrequiredstrengthanddimensions. The
machine shall contain hydraulic Press or advanced equipment to generate required compaction & Grade andfinish. Moulds/ Steel
Plates/ Dies of the machine shall be dimensionally checked & to be got approved before commencing theproduction. Contractor
shall prepare proper Drying Yard for keeping the blocks before curing. The drying yard shall be
levelledandcoveredsothatnoshrinkagecracksareformed.Contractorshallprepareadequatesizecuringpondtocuretheblocksfornotles
sthan21Days.Noothermeansofcuringshallbeallowed.ThetechnicalspecificationofconcreteshallconfirmtoIS456-
2000. The concrete mix is not required to be designed and only nominal mix as per IS: 456-2000 shall be followed. The
proportionof the concrete mix shall be 1:1.5:3 (1 cement: 1.5 coarse sand: 3 graded stone aggregate 20 mm. nominal size) by
volume.Concrete work shall have fairly exposed concrete surface or as specified in the item. The designation ordinary M-10, M-
15, M-20,M-25 specified as per I.S. corresponds approximately to 1:3:6, 1:2:4, 1:1.5:3 and 1:1:2 nominal mix of ordinary
concrete, byvolume respectively. The ingredients required for ordinary concrete containing one bag of cement of 50 Kg. by
weight (0.0342m3.) for different proportions of mix shall be as per IS 456-2000. The proportion of the aggregate for the kerb
stone shall bemodified as per the approval of the engineer-in-charge. The water cement ratios shall not be more than those
specified as per IS.The cement of the mix shall be increased, if the quantity of water in a mix has to be increased to overcome the
difficulties ofplacement and compaction so that the water cement ratio specified in the table is not exceeded. The maximum size
of coarseaggregate shall be as large as possible within the limits specified but in no case greater than 1/4th of the minimum
ofthemember,providedthattheconcretecanbeplacedwithoutdifficultysoastosurroundallreinforcementthoroughlyandtofill the
corners of the form. For reinforced concrete work, coarse aggregates having a nominal size of 20 mm. are generallyconsidered
satisfactory. Admixture shall be used in concrete only with approval of the Engineer-in-charge based upon theevidence that with
the passage of time, neither the compressive strength of concrete is reduced nor are other requisite qualitiesofconcrete impaired
bythe useofsuch admixtures.
Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50 kg weight. The volume
ofone such bag can be taken as 0.0342 m3. Boxes of suitable sizes shall be used for measuring sand and aggregate. The size of
theboxes (internal)shall be 30cm.x30 cm.and38 cm.deep. While measuring the aggregate andsand,the boxshall be filledwithout
shaking ramming or hammering. The proportioning of sand shall be on the basis of its dry volume and in case of
dampsand;allowancesforbulkageshallbe made.
For all work, concrete shall be mixed in a mechanical mixer which along with other accessories shall be kept in first class
workingcondition and maintained throughout the construction. Measured quantity ofaggregate, sand, and cement required for
eachbatch shall be poured into the drum of the mechanical mixer while it is continuously running. After about half a minute of
dry-mixing, measured quantity of water required for each batch of concrete mix shall be added gradually and mixing continued
foranother one and a half minute. Mixing shall be continued till materials are uniformly distributed and uniform colour of the
entiremassisobtainedandeachindividualparticleofthecoarseaggregateshowscompletecoatingofmortarcontainingitsproportionate
amount of cement. In no case shall the mixingbe done for less than 2 minutes after all ingredients have been putinto the mixer.
Mixers which have been out of use for more than 30 minutes shall be thoroughly cleaned before putting in a newbatch. Unless
otherwise agreed to by the Engineer-in-charge, the first batch of concrete from the mixture shall contain only2/3rds of normal
quantityof coarse aggregate. Mixing plant shall be thoroughlycleanedbefore changingfrom one type ofcement toanother.
The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete shall
bedetermined by regular slump tests in accordance with IS: 1199-1959. The slump of 10 mm. to 25 mm. shall be adopted
whenvibratorsare used.
All Moulds shall be cleaned and made free from standing water, dust, snow, or ice immediately before placing of
concrete.Formwork/MetalMould forexposed concrete surface(Ifindicated):
Allthemouldsshallbecheckedforexactdimensionsoftheprecastblocks.Alltheedgesoftheprecastblocksshallconfirmthe
profile of the final drawing & edges/ curvatures of the moulds shall be checked accordingly. Moulds shall be regularly checked
forcorrectnessofdimensionsofBlocks, twists, bendsdueto handling, etc.Beforestartingevery dayswork.
Care shall be taken to set all form work/Mould in perfect line, level (or in required camber or slope as specified) and plumb.
Formwork/Mould propping shall be strong, rigid, and sturdy. The form work/Mouldshall be as per pattern & design shown
indrawings. Form work/Mould shall be done accurately and precisely so as to achieve neat, clean and smooth concrete surface,
inline, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall not be allowed. Before placing
concrete,forms shall be thoroughly cleaned off of all rust, dust, and loose materials. Colourless oil or grease of approved quality
shall beappliedbeforeplacingsteel.Alsotheformworkmaterialwillbeofwood/plywood/steeloranysortofsuchmaterial,as
approved by the Engineer-in-Charge and/or his authorized representative; so that all exposed concrete surfaces have
Forallkindofexposedconcreteworkonlyonebrand(tobeapprovedbytheEngineer-incharge)ofcementshallbeused.
RemovalofMoulds:
Specific time shall be identified for removal of moulds, such that the concrete of the precast blocks shall gain strength
towithstand the stresses generated due to self weight and handling to drying yards without any deformation to shape/
dimensions/edges.
Sufficient time shall be given to the block after it is removed from the mould so that it can gain strength and dry in shade
toprevent anycracksdue to shrinkage. Thisshall be doneindryingyards.
Curingofblockshallbedoneonlyincuringpondandcuringshallbedoneforminimum14days.
Drying period after removing from pond & before delivery to site:Water should be drained of from the block before it is
actuallysent to the site. Time should be provided for proper draining of water which may be present in the block kept for curing
Precautionshallbetakenwhiletransportingoftheblocksto site.
Theblocksshouldbeloadedandunloadedwithduecaresoastoavoidgenerationofstressesleadingtobreakingofblock.Careshould be
taken toprevent the block from breakingduring transporting.
The pits of the size 150mm in width and required depth shall first be excavated, true to line and level. The relevant
specificationsof item A- 1 shall be followed for excavation work. The pits shall be filled with a layer of 50mm. thick sand bedding.
The curbsthen shall be placed in position of which 50mm. shall be below road. Care should be taken to maintain proper line and
level.Thejointsbetween thekerbsshallbepointed withC.M.1:2and curedforminimumsevendays.
Samplingandtestingofconcrete:
Samples from fresh concrete shall be taken as per IS : 1199-1959 and cubes shall be made, curedand tested at 7 days or
daysas per requirements in accordance with IS : 516-1959. A random sampling procedure shall be adopted to ensure that
eachconcrete batch shall have a reasonable chance of being tested i.e. the sampling should be spread over the entire period
ofconcretingandcoverallmixing units.
At least 1 sample shall be taken from each shift. Ten test specimens shall be made from each sample, 5 for testing at 7 days,
andthe remaining 5 at 28 days. The samples of concrete shall be taken on each day of the concreting as per above frequency.
Thenumber of specimens may be suitably increased as deemed necessary by the Engineer-in-charge when procedure of tests
givenabove reveals a poor quality of concrete and in other special cases. The average strength of the group of cubes cast for each
dayshall not be less than the specified cube strength of 200 Kg/cm2 at 28 days. 20% of the cubes cast for each day may have
valueless than the specified strength provided the lowest value is not less than 85% of the specified strength. If the concrete
made inaccordance with the proportions given for a particular grade, does not yield the specified strength, such concrete shall
beclassified as belonging to the appropriate lower grade. Concrete made in accordance with the proportions given for a
particulargrade shall not,however,be placedinahighergrade onthe ground thatthe teststrengthare higherthanthe
minimumspecified. If rock pockets/honeycombs in the opinion of Engineer-in-charge are of such an extent or character so as to
affect thestrength of the structure,materially or toendanger the life of the steel reinforcement, he may declare the concrete
defectiveand requirethe removalandreplacement oftheportionofthe structureaffected.
PrecastKerbStones:
The relevant specifications of concreting as per item above shall be followed except that work shall be carried out for
precastconcrete kerb stones as specified in the item. All Precast members shall be cast at workshop. Sufficient curing shall be
donebefore placement of the samethe method of transporting and placing the precast members shall be as approved by
theEngineer-in-charge. Members shall be so transported that no breakage or undue stresses are induced in them. If required,
allmembers shall have a key provided on both the faces i.e top and bottom surfaces, of adequate size so as to fill the same
withconcrete while laying. The function of this key is to avoid the leakage through the joint between the precast member and
thememberonwhichit islaid.
ModeofMeasurementsandPayment:
Therate shallinclude costof formworkandcost ofreinforcement. Thevolumeoccupiedbyreinforcement shallnot
bedeductedfromR.C.C.work.
The rate shall be for a unit of Rmt.
Supplying and fixing of 300 mm-L x 150 mm-B x 380 mm-H Kerb block for Footpath in M-20 grade using 20 mm nominal size
blacktrap aggregateof Sevaliya/Timba or equivalent quality for pre-cast blocks, reasonably exposed finish/ formwork
,mould with well equipped with vibratory system for kerbstones ofapproved designincluding curing, etc. complete, including
the cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level
on 5 cm thick sand bedding with necessary equipments and materials. The rate shall also include theflush pointingin CM
(1:3) forall jointsof thekerbstones. Filling ofzari alonethe sidesof thekerb stonefixed withBituminous concretemixed
inproper position as directed by Engineer in change to form a portable mixture. In any case Gravel or such type of materials shall
not be allowed for production. a) Laying on 5 cm thick Sand Bedding .
SpecificationasperItem No. 5 onlysizeofkerbasmentionedinAbstract.
Themodeofpaymentforthisitemshall beon Rmt. Basis.
Pre castconcrete kerbProviding andfixing M25 Grade of concrete precastexposed /Fair finish/ texturefinish kerb stones of
approved make as per approved sample of any size and any type. Kerbs shall be fixed on the foundation prepared as per approved
design. The rate shall also include for erecting and fixing the pieces in position for complete kerb system with chamfered typeof
kerbsincluding necessaryaccessories ofkerb like radius kerb, angles and quadrant kerbs, droplet kerbs etc. complete asper
drawing. Kerb shallbe fixedas paperjoint withoutany jointing material. However cement mortar shall be provided at the
backside of kerb stone joint. (Sample must beapproved) Costof excavation, cutting ,base , side filling shall includes as directed
engineer - incharge in above item description asper BOQ (a) 450hight x 600x 150 mm high median kerb.
Themodeofpaymentforthisitemshall beon Rmt. Basis.
Pre castconcrete kerbProviding andfixing M25 Grade of concrete precastexposed /Fair finish/ texturefinish kerb stones of
approved make as per approved sample of any size and any type. Kerbs shall be fixed on the foundation prepared as per approved
design. The rate shall also include for erecting and fixing the pieces in position for complete kerb system with chamfered typeof
kerbsincluding necessaryaccessories ofkerb likeradius kerbs, anglesand quadrantkerbs, dropletkerbs etc.complete asper
drawing. Kerb shallbe fixed as paper jointwithout anyjointing material. However cementmortar shall be provided atthe
backsideof kerbstone joint. (Sample must be approved) Cost of excavation, cutting ,base ,side fillingshall includesas
directedengineer -incharge in above item description as per BOQ (b) 380 x 600 x 150 mm high Footpath kerb.
Themodeofpaymentforthisitemshall beon Rmt. Basis.
Providing & laying Mountable type Central Verge including casting of Kerb of size 15.00 x 32.50 Cm by mechanical Kerb casting
machinery and oil paint colour to Center verge (Kerb) by Yellow/white and Black patta (Three Coat) one coat of priming & two
coat of oil Paint including cost of material required for paint and all labourworketc complete as per direction, detailed
drawing and instruction of engineer incharge .(Including Epoxy Piant of Approved Quality)
(Central Verge)
Themodeofpaymentforthisitemshall beon Rmt. Basis.
Supplying and fixing for central verge 230 mm L x 235 mmWidth x 680 mm H Supplying & Fixing in M-20 grade using
mmnominalsizeblacktrapaggregateofsevaliya/timbaorequivalentqualityforpre-
castblocks,reasonablyexposedfinish/formwork,mouldwithwellequippedwithvibratorysystemforkerbstonesofapproveddesigni
ncludingcuring,etc.complete,including the cost of formwork etc.complete.THe rate shall also include necessary cutting of
asphalt,fixingthe kerb stones in line and level on 5 cm thick sand bedding with necessary equipments and materials.The rate
shall alsoinclude the flush pointing in CM(1:3)for all joints of the kerbstones.Filling of Zari alone the sides of the kerb stone
fixed withbituminous concrete mixed in proper position as directed by engineer in charge to form a portable mixture.In any
case gravelor suchtypeof materials shallnotbe allowedforproduction.
Work shall be carried out as per item description including cost of all labour and materials etc. complete as directed.
Generalstandard practice ofwork isapplicable.
ThemeasurementsshallbeonRmtbasis.
Providing and Laying of Rubber Moulded Paver Block Grey/Coloured 60 mm thick, M-35 Grade of any size ; shape (Usually Uni-
Paver Blocks) using black trap good quality aggragate of 20 mm nominal size for footpath, parking areas, service lanes
andother areas as mentioned in the drawing / instruction of Engineer-in-Charge and/or his authorized representative.
Costincludes formworks using rubber mould, Rate providing and laying paver blocks as per required grading and specification.
Thepaver block shall be mechanically compacted. The work of paving blocks shall be executed in line and level by skill mason
offlooring work only. It should be laid in such a way that the no cutting of the paver block to be necessary. if cutting of
paverblock necessary then it should be cut by machine only and carting. The finished surface of the paver block shall have
resonablygood, plain finished. Paver blocks shall be compacted and shall be relaid if necessary. Gravel or such type of
materials shall notbe allowedfor production.Layingon50mmthick sandbedding.
• Layingon50mmthicksandbedding.
Excavation and compaction up to 300 mm in height for footpath paving in all sorts of soil murrum includingsorting
outsandstackingofusefulmaterialsstuffupto 50mt.
The scope of work includes manufacturing, supplying, and lying of precast paver blocks at various Retail outlets. The
workincludes: Verification of the existing site condition and advising our project in charge to lay suitable base course if
required.Contractors are required to satisfy themselves with quality of sub grade, sub-base course before the paver blocks are
laid andsuggest strengthening ifrequired.
Clearing the site by removing all obstacles such as stones, debris etc. for laying of paver blocks. Manufacturing of paver blocks
inyour plant as per requirements in technical specification enclosed. Supplying of paver blocks at site, including handling at
Laying of paver blocks at site as per requirement in technical specification on 50 mm thick sand bedding, within shortest
possibletime the site is public place hence care should be taken to ensure that the routine activities should not be disturbed. The
job oflayingmayrequired tobe carried outduringnightalso.
TestingofpaverblocksshallthroughreputedGovt./NonGovt.Testhouseonlyandsubmissionoftestresultsasperrequirements in
Technical Specifications. AMC reserves the right to carryout test at random. Cost for such tests to be borne byparty. The
contractor shall guarantee that all material and components designed, fabricated, supplied, and laid by him shall befree from any
type of defect due to faulty material and/or workmanship/erection for a period of One year from the date ofcompletion
ofwork.However,thecontractorone year'sshallrender freemaintenance.
TECHNICALSPECIFICATIONS:
PaverBlockManufacturingFacilities:
ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:
ConcreteBlockmakingMachines:
The machine shouldbe capable of producinghighqualityPaverBlocks byobtaininghighlevelof compactionbyapplication of
hydraulic compaction and also by high intensity vibration to the moulds. The machine should haveautomaticcontrol
foruniformityinstrength.
ConcreteBatching&MixingPlant:(Notessential)
The concrete Mix Design should be followed for each batch of materials. The concrete ingredient should be mixed
inconcrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The plant should equipped with
automaticcontrol panel formaintaining watercement ratiofrombatch to batch to obtain concrete of uniform quality
andstrength.Theplantshouldbeequippedwithadequatemechanismformechanizedloadingofrawmaterialsintomixer
andconveyorbeltfortransportationofconcretefrommixertoconcreteblockmakingmachinetomaintainqualityofwet cement.
Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.
Laboratory(Desirablebutnotessential):
The testing equipment should have required in the Laboratory as perthe
following:ACompression testingmachineofadequate capacity.
Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.
Systematic record of test results of various paver blocks manufactured in the
factory.ConcreteMixDesignfor variousgradeofconcreteusedformakingofpaverblocks.
SpecificationsForColouredPaverBlocks:
Coloured concrete paver blocks shall be manufactured as per attached specifications using or equivalent
approvedcolourPigmentof“BAYER”Make“BAYFERROXIRONOXIDEPIGMENTS”withminimumcolourpigmentof3%byweight
of cement. The colour shade shall be “RED” as selected by AMC before commencement of the work. White cement
shallbe used for colored pavers to obtain the desired colour shade. The job also includes providing 50 mm thick sand
beddingto matchthe shadeofthe paverblock.
Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingofthe
Allothertechnicalspecifications&Procedurefortesting,laying&samplingofcolouredpaverswillbeasperattachment.
PaversBlockCharacteristics:
The concrete pavers should have perpendicularities after release from the mould and the same should be retained
untilthe laying. The surface should be reasonably smooth and of anti skid and anti glare type. The paver should have
uniformchamfers to facilitate easy drainage surface run off. The pavers should have uniform interlocking space of 2mm
to 3mmto ensure compacted sand filling after vibration on the paver Surface. The concrete mix design should be
followed foreach batch of materials separately and automatic batching plant is to be used to achieve uniformity in
strength andquality.The pavers shall be manufactured in single layer only. Skilled labour should be employed for laying
blocks toensure line and level of laying, desired shape of the surface and adequate compaction of the sand in the joints.
Thepavers shall be of cement gray colour without any pigment & for coloured pavers refer “specifications for
colouredpave`” The pavers are to be skirted all round with kerbing using solid concrete blocks of size 150mm X 250mm X
380mm.The kerbing should be embedded for 100mm depth. The concrete used for kerbing shall be cured properly for
PaverBlockDimensions:
Shape Unipaver,IshapeordirectedbyAddl.C.E.
Chamfer 4mmto6mmalongtopedges
Colour Naturalcementgreycolourwithoutuseofanypigment.
Forcolouredpaversrefer“specificationsforcolouredpavers”
DimensionalTolerance (+/-)2mmforlength&width,
(+/-)3mmforHeight(Thickness)
TestingofPaverBlocks:
SR.NO *TEST AverageValues Frequency
1. CompressiveStrength Min.35N/Sqmmfor60mm 250Smt/1Test
2. FlexuralStrength Minimum4.5N/Sqmm
3. AbrasionResistance Maximum1.5
4. WaterAbsorption Maximum5.80%
*Samplingandtestingprocedureasperenclosedspecifications
SamplingandTestingProcedureforPaverBlocks
INTERNAL–Averageofminimum3samplesper 5000Blocks.
SamplingforTesting
SamplingofPaverblocks.
Methodofsampling :
Before laying paver blocks, each designated section comprising not more than 50000 blocks, shall be divided into
tenapproximately equalgroups. Threeblocksshallbe drawnfrom each group.
Markingandidentification:
All samples shall be clearly marked at the time of sampling in such a way that the designated section of part thereof,
andtheconsignmentrepresentedbythesample,areclearlydefined.
The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving intransit. Protect
the paving from damage and contamination until they have been tested. The testing shall be carried assoon as possible, after the
sample has been taken. As soon as practicable after sampling. The samples shall be stored inwaterat20degreeC5 degreeC for24
hourspriortotesting.
The item is to be executed as per instructions and to the entire satisfaction of Engineer-in-Charge and/or his
authorizedrepresentativeusingRubbermould andTablevibratorforKerb instead ofmechanicalpresssystem.
Extra rate for excavation of asphalt payment of any thickness including demolishing the asphalt carpet, metal, soling etc.complete
with stacking the materials as directed. The road surface of asphalt shall carefully be opened to full width asdirected by the
Engineer-in-Chargeand/or hisauthorizedrepresentative.
Excavationareashallbeproperlyidentifiedandmarkedinrectangularshape.Theroadcrustshallbeopeneduptoentire depth i.e. including
soling. All the materials shall be separately deposited in such a way and in places as may bedetermined by the Engineer-in-Charge
and/or his authorized representative. In case rubble not being so deposited orbeing mixed up with the excavated materials will
not be allowed for refilling. The cost of materials shall be charged fromthecontractor.The decision oftheC.E.shall befinal and
bindingtothecontract
For detailed specification for Laying of Paver Block on sand bedding, refer R & B Department booklet for
GeneralTechnicalSpecificationforbuilding works.
Therate shallbefor aunitofSMT
Providing and laying of interlocking grey paver blocks of high density 80mm thick made from M-40 grade concrete using 6 mm to
20 mm machine crushed well graded stone aggregate, sand of approved quality, OPC 53 grade cement with contractor's
ownconcrete mixdesign asapproved by AMC, for parking, road. Cost Includes formwork, using rubber/FRP mould, laying
paver block as per required grading and specification laid paver block shall be mechanically compacted. The work
of the paving blocks shall be executed in lineand levelby skilledmason offlooring work only. It should be laid in such a way
that the no cutting of the paver block to be necessary. Cutting of paver block by machine cut only and carting to be done. The
Finished surface of the Paver Block shallhave reasonablygood plain finish. Paver blocks shall be compacted and shall be re-laid
if necessary. Gravel or such typeof materialsshall notbe allowedfor production. Laying on 5 Cms thick sand bedding.
Therate shallbefor aunitofSMT
Paver Block Providing and laying shot blasted Non - interlocking, Paverblocks ofspecified thickness, size, grade of
concrete and colour machine made and blasting by automatic shotblasting machineand highdensity ofas perapproved
sampleof approvedmake forfootpath, parking areas, service lanes,cross over and other areas as mentioned in the drawing.
Including providingand laying50 mm thick averave bedding layer of coarse sand below paver block as per required grading and
specification. Laid paver block shall be mechanically compacted. The work of the paving blocks shall be executedin lineand
levelby skilledmason of flooring work only. Small size of paver block with same specification shall be used at residue or at end.
It should be laid in such a way that the no cutting of the paver block to be necessary. If cutting of paver block shall be required
,than cut by machine only andlaying tobe doneby skilledflooring mason. The finished surfaceof thepaver blockshall
havecoarse sand Texture Finish. Pave blocks shall be compacted and shall be re-laid if necessary. Actual laidarea shallbe
paid without any wastage. (A) 60 mm thick M-35 grade Grey
Therate shallbefor aunitofSMT
Providing and laying shot blasted Non - interlocking, Paver blocks of specified thickness, size, grade of concrete and
colourmachine made and blasting by automatic shot blasting machine and high density of as per approved sample of
makeforfootpath,parkingareas,servicelanes,crossoverandotherareasasmentionedinthedrawing.Includingprovidingand
laying 50 mm thick averave bedding layer of coarse sand below paver block as per required grading and specification.
Laidpaver block shall be mechanically compacted. The work of the paving blocks shall be executed in line and level by
skilledmason of flooring work only. Small size of paver block with same specification shall be used at residue or at end. It
should belaidinsuchawaythatthenocuttingofthepaverblocktobenecessary.Ifcuttingofpaverblockshallberequired,thancutby
machine only and layingto be done by skilled flooring mason. Thefinished surface of the paver blockshall have coarsesand
Texture Finish. Pave blocks shall be compacted and shall be re-laid if necessary. Actual laid area shall be measured andpaid
without anywastage. (A) 80mmthickM-35grade Grey Paver block ofsize200mmx200mm.
Thescope ofwork:It includessupplying andlaying ofPrecastshot blastedbyautomaticshot blasting
machineinfactory(noton site)paver blocksatfootpath, parking area, servicelaneand other areas.
Theworkincludes:
Paverblock shouldbelaidoverpreparedsubgrade.
Clearingthesitebyremovingallobstaclessuchasstones,debrisetc.forlayingofpaverblocks.
Manufacturingofpaverblocksbyoneoftheapprovedsuppliersasperrequirementsintechnicalspecificationenclosed.
Supplying ofpaverblocks atsite,including handlingatbothends.Thetype ofpaverblockmaybe interlocking ornon-
Providingandlayingaverage50mmcoarsesandbeddingforlayingblocks.
Layingofpaverblocksatsiteasperrequirementintechnicalspecification,withinshortestpossibletime.
Testing of paver blocks through reputed Govt. /Non Govt. Test house and submission of test results as per
inTechnicalSpecifications.Clientreservestherighttocarryouttestatrandom.Costforsuchteststobebornebycontractor.
The contractor shall guarantee that all material and components designed, fabricated, supplied and laid by him
freefromanytypeofdefectduetofaultymaterialand/orworkmanship/erectionforaperiodoffiveyearfromthedateofcomp
letionofwork atindividualsites.However,thecontractorforfiveyearsshallrenderfree maintenance.
TechnicalSpecifications:
PaverBlockManufacturingFacilities:
ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:
ConcreteBlockmakingMachines:
The machine should be capable of producing high quality Paver Blocks by obtaining high level of compaction by application
ofhydraulic compaction and also by high intensityvibration to the moulds. The machine should have automatic control panel
foruniformity instrength.
Concrete Batching & Mixing Plant: (Not essential) The concrete Mix Design should be followed for each batch of materials.
Theconcrete ingredient should be mixed in concrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The
plantshould be equipped with automatic control panel for maintainingwater cement ratio from batch to batch to obtain concrete
ofuniformqualityandstrength.
The plant should be equipped with adequate mechanism for mechanized loading of raw materials into mixer and conveyor
beltfortransportation ofconcretefrommixertoconcreteblockmakingmachineto maintainquality ofwet cement.
Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.Steamcuringfacilityofthepaverblocksisprefera
Laboratory(Desirablebutnotessential):
Thefactoryshouldhavethefollowing:
Compressiontestingmachineofadequatecapacity.
Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.
(1) Systematicrecordoftestresultsofvariouspaverblocksmanufacturedinthefactory.
(2) ConcreteMixDesignforvariousgradeofconcreteusedformakingofpaverblocks.
SpecificationsforColouredPaverBlocks:
ColourconcretepaverblocksshallbemanufacturedasperattachedspecificationsusingapprovedcolourPigmentofironoxideof
approved brand like Bayer, Tata etc. with minimum colour pigment of 3% by weight of cement. The colour shade shall be
asselected by Architect before commencement of the work. The job also includes providing 50 mm thick sand bedding to match
theshadeofthe paverblock.
The colour of the paver block shall be guaranteed against fading of colour for period of 12 months from the date of laying of
Allothertechnicalspecifications&Procedurefortesting,laying&samplingofColorpaverswillbeasperattachment.
PaverBlockCharacteristics:
Theconcretepaversshouldhaveperpendicularitiesafterreleasefromthemouldandthesameshouldberetaineduntilthelaying.
Thesurfaceshouldbereasonablysmoothandofantiskidandantiglaretype.Thepavershouldhaveuniformchamferstofacilitateeasydraina
ge surfacerunoff.
Thepaversshouldhaveuniform interlockingspaceof2mmto3mmtoensurecompactedsandfillingafter vibrationonthepaverSurface.
Theconcretemixdesignshouldbefollowedforeachbatchofmaterialsseparatelyandautomaticbatchingplantistobeusedtoachieveunifor
mityin strengthandquality.
Thepavers shallbemanufacturedinDoublelayeronly.
Skilledlabourshouldbeemployedforlayingblockstoensurelineandleveloflaying,desiredshapeofthesurfaceandadequatecompaction
ofthe sand inthejoints.
PaverBlockDimensions:
Layers Doublelayered,toplayerminimum8to10mm
Irregular(UniformShapewithnoHollowOrCracks)/asperdrawingCham
fer 4mmto6mmalong top edges
Colour NaturalcementgreyColour
withoutuseofanypigment.ForColourpaversrefer“specifica
tionsforColourpavers”
Dimensional (+/-) 2mm for length &
width,Tolerance (+/-)3mmforHeight(Thickness)
TestingofPaverBlocks:
* Samplingandtestingprocedureasperenclosedspecifications
Sampling&TestingProceduresforPaverBlocks:
INTERNAL – Average of minimum 3 samples per 10000 Blocks for compressive strength and water
absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.
SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppendix-A.
CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAppendix-
B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper thickness.
AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
FlexuralStrength:Testingfor flexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry Units).
Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks, shall
bedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal testing and
forexternaltesting.
Marking andidentification:All samplesshall beclearlymarkedat thetime of sampling insucha waythat thedesignatedsections of
part thereof, and the consignment represented by the sample, are clearly defined.The sample shall be dispatched tothe
approved test laboratory taking precaution to avoid damage to the paving in transit. Protect the paving from damage
andcontamination until they have been tested. The testing shall be carried as soon as possible, after the sample has been taken.
Assoonaspracticableaftersampling.Thesamplesshallbestored inwaterat 20degree Cfor24hourspriorto testing.
SR.NO. *TEST SPECIFICATIONAverageValues
(AverageofMinimumFiveSamples/Site)
1. CompressiveStrength Min.30N/Sq.mmfor60mmthickandMin.40N/Sq.mm
2. FlexuralStrength Minimum3.80N/Sq.mmand4.5N/Sq.mmfor60and80
mmthickpaverblockrespectively.
3. AbrasionResistance Maximum1.5
4. WaterAbsorption Maximum5.80%
5. MinimumCementContent 380Kg/CumforM 30 concreteand430Kg/CumforM40concrete
Sampling&TestingProceduresforPaverBlocks:
INTERNAL – Average of minimum 3 samples per 10000 Blocks for compressive strength and water
absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.
SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppendix-A.
CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAppendix-
B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper thickness.
AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
FlexuralStrength:TestingforflexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry Units).
Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks, shall
bedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal testing and
forexternaltesting.
Marking andidentification:All samplesshall beclearlymarkedat thetime of sampling insucha waythat thedesignatedsectionsofpart
thereof, andtheconsignment representedbythesample, areclearlydefined.
The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving in
transit.Protect the paving from damage and contamination until they have been tested. The testing shall be carried as soon as
possible,afterthesamplehasbeentaken.Assoonaspracticableaftersampling.Thesamplesshallbestoredinwaterat20degreeC5degre
eC for 24hoursprior totesting.
TestForCompressiveStrength:
Testing Machine: The testing machine shall be of suitable capacity for the test and capable of applying the load of the
ratespecified.It shallcomply, asregardsrepeatabilityand accuracy,with therequirementsofclause2.1ofBS:1881-Part4.
Procedure: The sample specimen shall be tested in a wet condition after being stored for at least 24 hours in water maintained
atatemperatureof20 C+or–5 C.Beforethespecimensaresubmergedinwater,thenecessaryareashallbedetermined.
The plates for testing machines shall be wiped clean and any loose grit or other material removed from the contact faces of
thespecimen. Plywood, nominally 4 mm thick shall be used as packing between the upper and lower faces of the specimen and
themachineplatesand theseboardsshallbelargerthanthespecimen by the margin ofat least5mm
atallpoints.FreshPackingshallbeusedforevery specimentested.
Thespecimenshallbeplacedinthemachinewiththewearingsurfaceinthehorizontalplaneandinsuchawaythattheaxesofthespecimenare
alignedwiththose ofthemachine plates.
Theloadshallbeappliedwithoutshockandincreasedcontinuouslyattherateofapproximately15N/Sq.mmperminuteuntilno greaterload
can be sustained.Themaximumload appliedto thespecimen shallbe recorded.
CalculationofcorrectedstrengthforindividualBlocks:Thecompressivestrengthofeachblockspecimenshallbecalculatedbydividingthe
maximumloadby fullcrosssection area oftheblock andmultiplyingwith anappropriatefactorof:-
a) For100mmthickblocks–
b) For80mmthickblocks–1.18
c) For60mmthickblocks –1.06
CompressiveStrengthCalculation:Theaveragecorrectedcompressivestrengthforthedesignedblocksectionshallbecalculated.
4.0Methodoflaying:
Blocksshallbeplacedonthesandbeddingetc.whichwerewellrammedsoastoactasfirmbed.Blocksshallbelaidinsuchmannerthatnogapsh
allbeleftinbetween.Blockssolaidshallbecompactedbymeansofmechanicalcompactororequivalent
compacting method so as to obtain required finished surface. All the joints shall be matched and if any manufacturing defect
isdetectedthelotshallbereplacedandrelayingshallbedonewithoutanyextracostuptosatisfactionofEngineerincharge.
50 to 80mm thick coarse sand shall be laid as cushioning layer for arranging the paver blocks. Joints of the paver blocks shall
befilled withthe sand.
The paver blocks shall be laid properly on the prepared sub-base as per manufacturer's specification and as per Architect
andEngineer-in-charge'sinstruction.
Paver block shall be laid by the approved agency only. If manufacturer of the paver block providing the laying services, then
itshall be laid through the supplying agency only. The labourers for paver block fixing shall be skilled flooring mason only.
Onlycutting tool shall be used for cutting the paver block. Full depth cutting toll shall be used for proper finished surface after
cutting.Manualcutting orbreaking ofthe paver block isnot permitted.
After laying of the paver block fine sand shall be spread over it and paver block shall be compacted with mechanical
compactor.Any settlement or undulationinthelaid areashallbe repaired immediately.
ModeofMeasurementand payment:
Measurementshallbedoneasperactualarealaidwithoutconsideringanywastage.
TheMeasurementoftheitem shallbeinSqmtbasis.
Labour work of fixing kurb any design of central verge, (both side) footpath kurb, items includes necessary excavation,
asphaltcutting of any thickness, erecting in line and position and pointing with cement mortar (1:3), watering, etc complete,
fillingwithzarialongthesideofthekurb,thekurbstonefixpreparedwithbitumnioustopsurface,asdirectedbyengineerincharge.
Work shall be carried out as per item description including cost of all labour and materials etc. complete as
directed.General standardpracticeof layingof paverblockis applicable.
ThemeasurementsshallbeonRMT basis.
Providing and laying cement concrete 1:5:10 (1- Cement : 5- fine sand : 10- graded brick bat aggregates 40mm nominal
size)and curingcomplete.
Before starting the concrete the bed of the foundations trenches shall be cleared of all loose materials and watered and
rammedas directed. The proportion of cement, sand and hand broken stone aggregates shall be one part of cement, 5 parts of
coarsesand, 10parts of hand broken stone aggregates and shall so measured by volume. The concrete shall be mixed in a
mechanicalmixer at the site of work. Hand mixing may however be allowed for smaller quantity of work if approved by the
Engineer-incharge.WhenhandmixingispermittedbytheEngineer-
inchargeincaseofbreakdownofmachinery’sandintheinterestofthe work. itshall be carriedout on a water tight platform and care
shall be taken to ensure that mixing is continued until themass is uniform in colour and consistency. The quantity of water
shall be sufficient to produce a dense concrete of requiredworkability for the purpose. The concrete shall be handled from the
place of mixing to the final position in not more than 15minutes by the method as directed and shall be placed into its final
position, compacted and finished within 30 minutes of mixingwith water i.e. before the setting commences. The concrete shall
be laid in layers of 15 cms. to 20 cms. The concrete shall berammed with heavy iron rammers and rapidly to get the required
compaction and to allow all the gaps to be filled with mortar.After the final set, the concrete shall be kept continuously wet, if
required by pounding for a period of not less than 7 days fromthe date of placement The concrete shall be measured for its
length breadth and depth, limiting dimensions to those specified onplan or asdirected.
ModeofmeasurementsshallbeonCMTbasis
ProvidingTMTBarFE500DreinforcementforR.C.C.Workincludingbending,bindingandplacinginpositioncompleteuptofloortwolevel.
ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.
Modeofmeasurementsshall beonKgbasis.
ProvidingandCastinginsituordinarycement concrete M200 for R.C.C. Raftand cutt off walls including necessaryshutteringlaying,
vibrating,ramming andcuring complete.(B)Walls, fomtopof foundationlevel uptofloortwolevel(upto10ton).
ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.
Modeofmeasurementsshall beonCMTbasis.
Providing andsetting 50to 60 mm thick rougekotah stone water table in line, level and in required gradient including
mm thick beddcingin C.M.1:6 (1 Partof cement :6 Partof coarsesand) with sufficient ramming consolidation. Providing joints
in C.M. 1:3 (1 Part of cement : 3 Part coarse sand) and smooth pointing inC.M. 1:1 (1 Part of Cement, 1 Part of coarse sand)
including watering etc. complete and as per details in tender specification & as directed by engineer in charge.
Size : 1' x 1'(40 to 50 mm thick)
Modeofmeasurementsshall beon RMTbasis.
Labour workfor fixingany kindof pavingwith cementpointing in CM 1:2, including watering, ramming etc comp. as directed
Laying on Sand bedding as per requirement to fix theC.C.Block / Nibhada Stone in Line & Level.
Modeofmeasurementsshall beon SMTbasis.
For Water Table &Kerbon Sand bedding as per requirement to fix the C.C.Block / Nibhada Stone in Line & Level.
Modeofmeasurementsshall beon RMTbasis.
Construction of RCC nosing in central verge using M-200 grade cement concrete. The item includes cost ofcentering
&shuttering, reinforcement, both sidecement plasterin C:M 1:3 mortar&curing etc. complete. Half roundportion of the
nosing shall be made by using mild steel.
Modeofmeasurementsshall beon NO.basis.
Providing and laying in position Ready Mixed M-200 grade concrete for reinforced cement conctere work, using cement content
as per approved Design Mix manufactured in fully automatic batching plant and transported to site of work intransit mixer for a
lead up to 10 kms having continuous agitated mixer, manufactured as per mix design of specified grade for reinforced cement
concrete work including pumping of R.M.C. from transit mixer to site of laying, excluding the cost of centering shuttering finishing
and reinforcement including cost of admixtures in recommended proportions as per IS:9103 to accelerate/ retard setting of
concrete, improve work ability without impairing strength and durability as per direction of theEngineer-in-charge. Without Fly
Ash (Min cement level as per latest IS456 shall be maintained) (Cement level 400 kg )
Modeofmeasurementsshall beon CMT.basis.
Provdg. Form work of ordinary timber planking so as to give a rough finish incl. centering, shuttering, strutting and propping etc.
height of propping and centering below supporting floor to ceiling not exceeding 4 M & removal of the same for in situ reinforced
concrete and plain concrete work in
Modeofmeasurementsshall beon SMT.basis.
P/A Trimix with dewatering machine and floater machine on constructed RCC work incl.cost of machine and labouretc comp as
Modeofmeasurementsshall beon SMT.basis.
Making 15 mm groove in RCC work on road and filling it with polysulfiedselant and finished it good incl.alllabour charges etc
comp as directed.
Modeofmeasurementsshall beon RMT.basis.
Hiring of tractor with trolley considering 8 Hrs. as working day hours incl.Driver
Modeofmeasurementsshall beon DAY.basis.
Providing chotahathi or driver with fuel , to carry out different works during day/night for 8 hrs. shift. Work shall be carried out
as per the instructions of Engineer in charge 4 Nos of labour all necessary permit etc. comp. (For 8 hours shift )
Modeofmeasurementsshall beon SHIFT.basis.
Providing & Supplying JCB Machine on rental basis in case of emergency situation and break down type work & also during
unavoidable condition as per instruction of engg.incharge, rate includes all nece. shifting, fuel and operating charges and stacking
of useful & non-useful materials separately up to store. (No payment should be allowed for non working condition of machinery
and for pipe line excavation and laying work) (Based on Previously approved rate by CE sir )
Modeofmeasurementsshall beon HOUR.basis.
Supplying Pneumatic Breaker Machine for RCC Slab or Asphalt Demolishing Work on site by using Operator, fuel, power Supply
etc. Complete as Directed. (No payment should be allowed for non working condition of machinery and for pipe line excavation
and M.H. work. Allowed only for break down work) (Based on Previously approved rate by C E sir )
Modeofmeasurementsshall beon HOUR.basis.
Repairing damaged M.H. and rasing M.H. up to road level incl. removing damaged brick work and repairing by brick masonry in
C.M. 1:5 and plaster in C.M. 1:3 and fixing C.I. steps and existing MH sheet cover, removing the debris from MH and carting the
same as directed.
Modeofmeasurementsshall beonNOS.basis.
Repairing damaged I.C./ Raising removing damaged brick work and repairing by brick masonry in C.M. 1:5 and plaster in C.M.
1:3 and fixing C.I. steps and existing chamber sheet cover, removing the debris from chamber and carting the same as directed.
Modeofmeasurementsshall beonNOS.basis.
Providing F.R.C. MH seat cover incl. carting to the work site etc. comp. Directed.
A. F.R.C. Extra HeavyDuty (EHD-35) ManholeCovers & Frames Cover : 728mm ø & 100 mm thick circular cover, 35.00 MT load
design, 100x2mm MS flat allround, 16mm ø plain round bar for lifting the cover & should be fitted with plastic cups. Frame :
560 mm ø clear opening, outer size- 888x888x175 mm. On the upper periphery of frame 25 x 3 mm wide MS flat should be
well embed in concrete to protect the edges of frame. FRC E.H.D.-35 manhole cover & frame described as above
B. F.R.C. Heavy Duty [HD-20] Machinehole Covers - 560 mm ø clear opening, The dimension of frame and cover as per
mentioned in Amend No.1 to IS 12592 : 2002 table
C. F.R.C. Medium Duty [MD-10] Machinehole Covers - 560mm ø clear opening, The dimension of frame and cover as per
mentioned in Amend No.1 to IS 12592 : 2002 table 1..
D. F.R.C. Medium Duty [MD-10] Chamber Covers & Frame- 600 x 450 mm clear opening, The dimension of frame and cover as
per mentioned in Amend No.1 to IS 12592 : 2002 table
E. F.R.C. Light Duty [LD-2.5] Machinehole Covers & Frames-560mm ø clear opening, The dimension of frame and cover as per
mentioned in Amend No.1 to IS 12592 : 2002 table
Modeofmeasurementsshall beonNOS.basis.
Carting and Fixing M.H., Chamber or Catchpite Seat and Cover in line and level to match exisisting road level in C.C. 1:2:4 and
finishing smooth, watering and protecting for 7 days etc. complete as directed. M.H. seat cover will be supplied byA.M.C.(from
Modeofmeasurementsshall beonNOS.basis.
Supplying, labour for break down repairing work for activities like excavation, disliting, removing debris from trench back filling
etc. comp. as directed by Eng.in charge.
Modeofmeasurementsshall beonNOS.basis.
Constructing Bombay Pattern Type Catch Pit of size 0.60 x 0.60 depth up to 1 mt including excavation, B.B.C.C. (1:5:10), 23 cms
thick brick maso. wall in the prop. of CM (1:6) with 40 mm thick IPS flooring in the prop M15 at bottom and 15 mm thick cement
plaster inside the catch pit in the proportion of CM (1:3) with outjali etc. comp. as directed.
Modeofmeasurementsshall beonNOS.basis.
CatchPit Jali (Heavy duty) Fixing P/F FRC catch pit jali with frame 600mm x 600mm clear opening etc. comp.. As directed by
engineer in charge.
Modeofmeasurementsshall beonNOS.basis.
Providing, laying, spreading and compacting graded stone aggregate to wet mix macadam specification including premixing the
Material with water at OMC in mechanical mix plant carriage of mixed Material by tipper to site, laying in uniform layers in sub-
base / base course on well prepared surface and compacting with vibratory roller to achieve the desired density as per Codal
Production & Supply of WMM to site of
worksLayingof WMM
This work shall consist of laying and compacting clean, crushed, graded aggregate and granular material, premixed with water,
toa dense mass on a prepared sub-grade/sub- base/ base or existing pavement as the case may be in accordance with
therequirements of these Specifications. The material shall be laid in one or more layers as necessary to lines, grades and cross-
sectionsshownon the approved drawingsorasdirected bytheEngineer.
The thickness of a single compacted Wet Mix Macadam layer shall not be less than 75 mm. When vibrating or other
approvedtypes of compacting equipment are used, the compacteddepth of a single layer of the sub-base coursemay be upto
mmwith the approval ofthe Engineer.
PhysicalRequirements
Coarseaggregatesshallbecrushedstone.TheaggregatesshallconformtothephysicalrequirementssetforthinTable19-1.
Sevaliya/Timba/Ankodiyaspecialaggregateisonlyacceptable.
Ifthewaterabsorptionvalueofthecoarseaggregateisgreaterthan2percent,thesoundnesstestshallbecarriedoutonthematerialdelivered
to site asperIS:2386 (Part-5).
Table19-1:PhysicalRequirementsofCoarseAggregatesforWetMixMacadamforSub-base/BaseCourses
S.No. Test TestMethod Requirements
1. LosAngelesAbrasionvalueorA IS:2386(Part-4) 40percent(Max.)
ggregateImpact value
IS:2386(Part- 30percent(Max.)
2. CombinedFlakinessandElongationindices(To IS:2386(Part-1) 35percent(Max.)*
* To determine this combined proportion, the flaky stone from a representative sample should first beseparated out. Flakiness index is weight of flakystone
metal divided by weight of stone sample. Only the elongated particles be separated out from the remaining (non-flaky) stone metal. Elongation index
isweightofelongatedparticlesdividedbytotalnon-flakyparticles.Thevaluesofflakinessindexandelongationindexsofoundareaddedup
GradingRequirements
TheaggregatesshallconformtothegradinggiveninTable19-2.
Table19-2:GradingRequirementsofAggregatesforWetMixMacadam
ISSieveDesignation PercentbyweightpassingtheISSieve
Materialfinerthan425 micronshallhavePlasticityIndex(PI)notexceeding6.
The final gradation approved within these limits shall be graded from coarse to fine and shall not vary from the low limit on
onesievetothehighlimit ontheadjacentsieve orviceversa.
Construction Operations:-
Preparation ofBase
The surface of the sub-grade/sub-base/base toreceive the Wetmixmacadam courseshall be preparedtothe specifiedgradeand
camber and cleaned of dust, dirt and other extraneous material. Any ruts or soft yielding places shall be corrected in anapproved
manner and rolleduntil firmsurface isobtained.
Where the Wet mix macadam is to be laid on an existing metalled road, damaged area including depressions and potholes
shallbe repaired and made good with the suitable material. The existing surface shall be scarified and re-shaped to the required
gradeand camberbeforespreadingthe coarseaggregate forWetmixmacadam.
PreparationofMix
WetMixMacadamshouldbepreparedinanapprovedmixingplantofsuitablecapacityhavingprovisionforcontrolledadditionof water
and forced/positive mixing arrangement like pugmill or pan type mixer of concrete batching plant.For small quantity ofwet
mixwork,theEngineermay permitthemixingtobedone in concrete mixers.
Quantityof watershouldnotvaryfrom OMC determinedas perIS : 2720 (partVIII)bymore thanagreedlimit.The mixedmaterialshould
be uniformly wetand nosegregation should be permitted.
Immediately after mixing, the aggregates shall be spread uniformly and evenly upon the prepared subgrade/sub-base/base
inrequired quantities. In no case should these be dumped in heaps directly on the area where these are to be laid nor shall
theirhaulingover a partlycompleted stretchbe permitted.
The mix may be spread either by a paver finisher or motor grader or as per instruction of Engineer-in-Charge and/or
hisauthorized representative. For portions where mechanical means cannot be used, manual means as approved by the
Engineershall be used.The motor grader shall be capable of spreading the material uniformly all over the surface. Its blade shall
havehydrauliccontrolsuitableforinitialadjustmentsandmaintainingthesame soasto achievethespecifiedslopeand grade.
Thepaver finishershallbeself-propelled,havingthefollowingfeatures:
(i) Loadinghoppersandsuitabledistributionmechanism
screedshallhavetampingandvibratingarrangementforinitialcompactiontothelayerasitisspreadwithoutruttingorotherwisemarringth
e surface profile.
(iii) Thepavershallbeequippedwithnecessarycontrol mechanismsoas toensurethatthefinishedsurfaceisfreefrom surfaceblemishes.
The surface of the aggregate shall be carefullycheckedwithtemplates andall high or low sports remediedbyremoving oradding
aggregate as may be required. The layer may be tested by depth blocks during construction. No segregation of layer
andfineparticlesshouldbeallowed.Theaggregatesasspreadshouldbeofuniformgradationwithnopocketsoffinematerials.
Afterthemixhasbeenlaidtotherequiredthickness,gradeandcrossfall/camberthesameshallbeuniformlycompacted,tothefulldepthwith
suitableroller.Ifthethicknessofsinglecompactedlayerdoesnotexceed100mm,smoothwheelrollerof80to
100 kN weight may be used. For a compacted single layer upto 200 mm, the compaction shall be done with the help of
vibratoryrollerofminimum staticweightof80to100kNorequivalentcapacityroller.Thespeedoftherollershallnotexceed5km/h.
In portions having unidirectional cross fall/superelevation, rolling shall commence from the lower edge and progress
graduallytowards the upper edge. Thereafter, roller should progress parallel to the centre line of the road, uniformly over-lapping
eachpreceding trackbyatleastone thirdwidthuntil theentire surfacehas beenrolled.Alternate trips of the rollershallbeterminated
instopsatleast 1m away from any preceding stop.
In portions in camber, rolling should begin at the edge with the roller running forward and backward until the edges have
beenfirmly compacted. The roller shall then progress gradually towards the centre parallel to the centre line of the road
uniformlyoverlappingeach oftheprecedingtrack by at least one-third width untiltheentiresurfacehasbeen rolled.
Any displacement occurring as a result of reversing of the direction of a roller or from any other cause shall be corrected at
onceasspecifiedand/or removedandmade good.
Along forms, kerbs, walls or other places not accessible to the roller, the mixture shall be thoroughly compacted with
mechanicaltampers or a plate compactor. Skin patching of an area without scarifying the surface to permit proper bonding of the
addedmaterialshall notbepermitted.
Rolling should not be done when the subgrade is soft or yielding or when it causes a wave-like motion in the sub-
base/basecourse or subgrade. If irregularities develop during rolling which exceed 12 mm when tested with a 3 metre straight
edge, thesurface should be loosened and premixed material added or removed as required before rolling again so as to achieve a
uniformsurfaceconformingtothedesiredgradeandcrossfall.Innocaseshouldtheuseofunmixedmaterialbepermittedtomakeupthe
depressions.Rolling shall be continued till the density achieved is at least 98 per cent of the maximum dry density for
thematerialasdetermined by the method outlinedin IS :2720(Part-8).
Aftercompletion,thesurfaceofanyfinishedlayershallbewell-closed,freefrommovementundercompactionequipmentorany
compaction planes, ridges, cracks and loose material. All loose, segregated or otherwise defective areas shall be made goodto
the fullthicknessofthelayer andrecompacted.
Settinganddrying:
Afterfinalcompactionofwet mixmacadamcourse,theroadshallbeallowedtodryfor24hours.
OpeningtoTraffic
Preferably no vehicular traffic of any kind should be allowed on the finished wet mix macadam surface till it has dried and
thewearingcourse laid.
Surface Finish and Quality Control of
WorkSurface evenness:
ThesurfacefinishofconstructionshallconformtotherequirementsofClauseinItemNo.16&17&18.
Qualitycontrol:
ControlonthequalityofmaterialsandworksshallbeexercisedbytheEngineerasperTable19-3.
Table19-3:TestandFrequencyforMaterialsforWetMixMacadam
Type Test Frequency ISCode
ofConstructi (Asper CircularNo.66)
Wet Gradation Onetestper200Cu.m. IS:2386,Part-I-1963
MixMacada AggregateImpactValue Onetestper1000Cu.m. IS:2386,Part-IV
Combined Flakiness Onetestper500Cu.m. IS:2386,Part-I
andElongationIndices
Atterberg Limits of portion Onetestper200Cu.m. IS:2720,Part-V
ofaggregatespassing
Densityofcompactedlayer Onesetofthreetestsper IS:2720,Part-VIII
RectificationofSurfaceIrregularity
Where the surface irregularity of the wet mix macadam course exceeds the permissible tolerances or where the course
isotherwise defective due to subgrade soil getting mixed with the aggregates, the full thickness of the layer shall be scarified
overthe affected area, reshaped with added premixed material or removed and replaced with fresh premixed material as
applicableand recompacted. The area treated in the aforesaid manner shall not be less than 5 m long and 2 m wide. In no case
shalldepressionsbefilledup withunmixed andungraded materialor fines.
ArrangementforTraffic
Duringtheperiodofconstruction,arrangementsforthetrafficshallbeprovided.TheContractorshalltakeallnecessarymeasures for the
safety of traffic during construction and provide, erect and maintain such barricades, including signs, marking,flags, lightsand
flagmenasper instruction oftheEngineer-in-charge.
MeasurementsforPayment
Therateshallbe foraunit ofonecubic meter.
Dismantling the following including loading, unloading and disposal of unserviceable material for all lead or as directed by
Engineer-In-Charge and stacking the serviceable material and backfilling the resulting trenches and pits complete.
(Based on Previously approved rate by CE sir )
A. central verge -kerb stone
B. Dismantling tiled or stone floors laid in mortar including stacking of serviceable material and disposal of uservicalble
material with all lead and lifts
Therateshallbe foraunit ofRMT/SMT BASIS.
Applying priming coat over new steel and any other surface after and including preparing the surface by throughly cleaning,
oil,grease, dirt and other foreign matter and scoured with brushes fine steel wood, scrapers and sand paper with ready mixed
priming paint brushing red lead.
Therateshallbe foraunit ofSMT BASIS.
Painting one coats (excluding proming coat) on previously painted steel and other metal surface with enamel paint, brushing to
give an even shade including cleaning the surface of all dirt, duct and other foreign matter.
Therateshallbe foraunit ofSMT BASIS.
Labour work for fixing interlocking blocks / any kind of pavement on up to 50 mm th sand bedding, levelling, watering and
fixing in line & level as well cleaning the site etc.comp. as directed.
Therateshallbe foraunit ofSMT BASIS.
Reinstatement work for Central verge and footpath Kerb Stone
Therateshallbe foraunit ofRMT BASIS.
Painting Two Coats on divider and footpath curb surface / New Concrete Surface ( Painting two coats after filling the surface with
synthetic enamel paint in all shades on new plastered concrete surfaces)
Therateshallbe foraunit ofSMT BASIS.
ThecolourandworkmanshipshallbeinaccordancewiththeCodeofPracticeforpainting,andasspecifiedinthedrawingsorasdirected bythe
Materials:SyntheticenamelpaintshallconformtoIS.
The materials required for work of painting work shall be obtained directly from approved manufacturers or approved dealer
andbrought tothesite in maker'sdrums, kegsetc.withseal unbroken.
All materials not in actual use shall be kept properly protected, lids of containers shall be kept closed and surface of paint in
openor partially open containers covered with a thin layer of turpentine to prevent formation of skin. The materials which
havebecome stale or flat due to improper and long storage shall not be used. The paint shall be stirred thoroughly in its
containerbefore pouring into small containers. While applying also the paint shall be continuously stirred in smaller container. No
left overpaint shallbeput back intostocktins.When not in use, thecontainersshallbekept properly closed.
Ifforanyseasons,thinningisnecessary,thebrandofthinnerrecommendedbythemanufacturershallbeused.
The surface to be painted shall be thoroughly cleaned and dusted. All rust, dirt and grease shall be thoroughly removed
beforepainting is started. No painting on exterior or other exposed parts of the work shall be carried out in wet, damp of
otherwiseunfavorableweatherand all thesurfacesshallbe thoroughly dry beforepainting work isstarted.
Brushing operations are to be adjusted to the spreading capacity advised by the manufacture of particular paint. The paint
shallbe applied evenly and smoothly by means of crossing and laying off. The crossing and laying off consists of covering the area
overwith paint, brushing the surface hard for the first time over and then brushing alternately in opposite directions two or
threetimesand thenfinally brushing lightly in directionat rightanglesto the same.
In this process, no brushmarks shallbe left afterthe laying off isfinished. The fullprocess of crossing and laying
offwillconstituteone coat.
Each coat shall be allowed to dry completely and lightly rubbed with very fine grade of sand paper and loose particles brushed
offbefore next coat is applied. Each coat shall vary slightly in shade and shall be got approved from Engineer-in-charge before
nextcoat isstarted.
Each coat except the last cost shall be lightly rubbed down with sand-paper of fine pumice stone and cleaned of dust before
thenext coat is applied. No hair marks from the brush or clogging of paint puddles in the corners of panels angles of mouldings
etc.shallbe lefton the work.
Approvedbestqualitybrushesshallbeused.
Modeofmeasurements&payment:
AnytypeofC.C.Centralvergescurbssurfaceshallbe measuredunderthisitem.
All theworkshall be measurednot inthe decimalsystemas executedsubject to thefollowing limits unless otherwisestatedhereinafter:
(a) dimensionsshallbemeasuredtothenearest0.01metre.
(b) Areasshallbeworkedouttothenearest0.01Sq.metre.
No deductions shallbe madeforopenings not exceeding0.5 sq.mt. eachandnoadditionshallbe madeforpainting
tobeadings,mouldings, edges,jambs, soffits,etc. ofsuchopening.
Thedifferentsurfacesshallbegroupedintoonegeneralitem,areasofunevensurfacebeingconvertedintoequivalentplain
areasinaccordancewiththemode ofmeasurementforpayment.
The rate shall be for a unit of one SMT.
I HAVE ALSO GONE THROUGH TECHNICAL SPECIFICATIONS FOR THE ITEMS (AS PER STANDARD P.W.D. TECHNICAL
SPECIFICATION FOR THE ITEMS AND ALSO I HAVE THE BOOK OF THE SAME) AND AGREE TO ABIDE BY THEM.
IN CASE OF WHERE IS NO TECHNICAL SPECIFICATION FOR THE ANY ITEMS AVAILABLE, SPECIFICATION GIVEN BY THE
ENGINEER-IN-CHARGE SHALL BE FOLLOWED AND FOR THE SAME I AGREE TO ABIDE BY THEM.
SealandSignatureoftheBidder Add.CityEngineer(WestZone)
AmdavadMunicipalCorporation
ybœtJtœBgwÂlÂmvjftuvtuohuNl
bntldhmuJtmœl–vrùbÍtul
vrùbÍtulÍtuljytuVem,
1. Wvhtuf<xuLzhtusu<u JdobtkbtLghSMx[uNl ^htJ<t ftuLx[tfxh©eytuyuChJt.
2. xuLzhlerlg<xuLzh Ve <&t R.yub.ze. ck^ fJhbtkkWvhltmhltbuÁcÁ / hSMxhyu.ze./MvezvtuMx/ fwhegh&erlg<mbgbtkbtufjJtlthnuNu.
3. ftuLx[tfxh©eytuyuxuLzhlemt&uBGþrlrmvjbtLghSMx[uNlle/ dJobuLxhSMx[uNlleftuve, (xuLzhftuve<&t yLgvwhtJtmt&u)
yawfmtbujfhJtlehnuNuylufJhWvhxuLzhlkch<&t ftuLxufxlkchsYhMvМNtoJJtltu hnuNu.ck^ fhJhWvhxuLzhltuxemlkch, xuLzhlkch,
ftblwkltb<&t, ftuLx[[tfxhlemkM&tlwkltb<&t ftuLxufxlkchyJ~gœNtoJJtlthnuNu. ftuLx[tfxhtuyuxuLzhbtcukflwltb, Ft<t lkch,
btRfhlkchylumhltbwMvÐyûthtubtkjFJw.
4. xuLzh Ve vu ytuzoh / zebtLzz[tVx&eaqfJJtlehnuNu. œhufxuLzhœeXyjdxuLzhxuLzhVeChJtlehnuNu.
5. ytuAehfblexuLzh Ve, R.yub.ze. fu xuLzh Ve, R.yub.ze. ÂJltltxuLzhtuhœct<j (fuLmj) dKtNu.
6. xuLzhmt&uBþfJtbtkytJ<e yluoMxble, xuLzhlehfblt 1% «btKucukfduhLxe / zebtLzz[tVx / vu ytuzoh / jtufjbtRfhauf&e s MJefthJtbtkytJNu.
œhufxuLzhœeXyjdR.yub.ze. ChJtlehnuNu. R.yub.ze. hfbYt. yuffhtuzmwDeleykœtS<hfbltftbbtxujtufjbtRfh auf, rzbtLzz[tVx, vu ytuzoh fu
cukfduhkxeltMJYvbtk<&t Yt. yuffhtuz&eWvhleykœtS<hfbltftbbtxuR.yub.ze.lehfbbtºtrzbtLzz[tVx, vu ytuzoh fu
ckufduhkxeltMJYvbtkytvJtlehnuNu.
7. cukf duhuLxe btºt ybœtJtœ Nnuhle s MJefthJtbtk ytJNu.
8. xuLzh Ve <&t R.yub.ze.le hfblt ze.ze./ aufle vtA¤ ftuLx[tfxh©eyu vtu<tle mkM&tlwk ltb <&t btuctRj lkch yJ~g jFJtltu hnuNu. ftuLx[t¾xhu
vtu<tle mkkM&tlt auf <&t ze.ze. xuLzh R~gw > <theF ctœlt s ytvJt.
9. Nh<e xuLzhtu hœ ct<j dKtNu.
10. stu xuLzhbtk MvÐ WÕjuF fhtguj ntug <tu atubtmtlu fthKu Ft<tfeg MËalt yLJgu ßgthu ßgthu ftb ck^ htFJtLþk &tg <u mbglu ftble BþÆ<btk bshu
ytvJtbtk ytJNu. vhkðþ yt yLJgu ftuE CtJ J^thtu ytvJtbtk ytJNu lne. sule ltuk^ >huf xuLzhh ujuJe.
11. xuuLzhtu ftuEvK fthK ytÃgt rmJtg MJefthJt fu lrnk MJefthJt <ule mkÃËKo m•tt BGþrlrmvj frbNlh©ele hnuNu.
12. xuLzhbtk stu ftuR mwDtht JDtht ntug <tu <u ykd xuLzh Ch<t vnujt AuÕju œJmu rlg< JucmtRx y&Jt fauheyu sYhe <vtm fhelu s xuLzh btufjJw.
13. mefgtuhexe zevtuÍex/ vVtuboLm duhuLxele hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf, rzbtLz z[tVx, vu ytuzoh fu cukf
duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu mefgtuhexe zevtuÍex/ vhVtuboLm duhkxele hfb btºt rzbtLz z[tVx, vu ytuzoh
fu ckufduhkxelt MJYvbtk ytvJtle hnuNu.
14. ytuljtRl yul-«tufgwh JucmtRx vh&e ChJtlt &<t xuLzhbtk ftuLx[tfxh/ yusLmeyu xuLzhle ntzo ftuvebtk CtJ Cgto Jdhle mne mefft fhe
mcbex fhJtle hnuNu. stu <ubtk CtJ Chuj nNu <tu <uJt xuLzh hœ fhJtbtk ytJNu.
15. dwsht< mhfth ©b,ftuiNÕg ylu htusdth rJCtd îtht XhtJ ¢btf:LED/WRT/e-file/11/2024/0293/M2 mraJtjg ,dtk^eldh
<t.15.02.24 lt XhtJ v{btKu yusLme/¢tuLx[fxhtulu îtht ©bgtude ftgœtle studJtR vhevqKo &tg <u mwrlµ< fhJtlwk hnNu.
16. mœh xuLzhbtk ” GST rl<e rlgb bwsc jtdw vzNu ” <u bwsc dK<he fhe xuLzhtu ChJtlt hnuNu.
zebtLzz[tVx / auf “BgwÂlÂmvjfÂb§h©e, ybœtJtœ” ltltbltufZtJJtu.
17. vhevºt 92 <t 20/01/2025 ltuawM<vKuybjfhJtltu hnuNu.
ybœtJtœBgwÂlÂmvjftuvtuohuNl
yu.yth.me. xuLzh- Nh<tu
1. yu.yth.me. xuLzhbtkJfoytuzhytÃgtctœftb NY fhJtlembgbgtoœtbtkftuLx[tfxhîthtftb NY fhJtleòKfgtoctœ
fjtfltftb NY lrnfhJtbtkytJu<tuyLgftuLx[tfxhvtmubtfuoxhux&eftuLx[tfxhltFaouylustuFbuftbdehefhtJJtbtkytJNu.
2. ftuLx[tfxhluJfoytuzohytÃgtctœ yu.yth.me. «fthlkwxuLzhntuRftblesYhegt<bwscxujeVtulefòKfhesu<u ftb NY
fhJtfnuJtbtkytJNuylusuftbleòKfgtolt 24 fjtfbtk NY
fhJtbtklrnytJuylurlg<mbgbgtoœtbtkvwKofhJtbtklrnytJu<tusu<u ytRxbltSOR CtJ&e
dKevulÕxeJmwjjuJtbtkytJNu.
3. The contractor shall adhere to the maintenance schedule outlined in the tender
documents and comply with the prevailing AMC circulars issued from time to time.
ºtK fu J^wJthWvhbwscleyLgftuLx[tfxhvtmu&eftbdehefhtJJtleVhsvzNuylu/y&Jt ºtK fu
J^wJthvulÕxefhJtleVhsvzNu<tu<u mkstudtubtkftuLx[tfxhluçjufjeMxfhJtbtkytJNusuleykr<b m•tt Bgw.frb¹lh©elu hnuNu.
4. The contractor shall adhere to the maintenance schedule outlined in the tender
documents and comply with the prevailing AMC circulars issued from time to time.
TenderConditionsforA.R.C.Contractorof Footpath.
ScheduleofmaintenanceWorkofPaverBlock&Footpath
Sr.No. Day PocketNo. Location Details of Repairing
(Smt)Footpath/Kerb/Colour
1 Monday, 1 132 feet ring road
Tuesday, LHS side
2 Thursday, Friday, 2 132 feet ring
Saturday road RHS side
(1) The agency will have to conduct a survey as per schedule mentioned above according to the area and
inform the Ahmedabad Municipal Corporation officer.
(2) The agency will have to deploy labor gang/ gangs within 24 hours of site shown by the Ahmedabad
Municipal Corporation officer.
(3) The agencywill have to start the work within 24 hrs after showing the site bythe Ahmedabad Municipal
Corporation officer.
(4) The agency will have to start the work as per the instructions of the Ahmedabad Municipal Corporation
officer from the next day. Otherwise, if the work is started late, a penalty of Rs.500/ daywill be imposed.
(5) If the agency is asked by the Amdavad Municipal Corporation officer to execute any additional work
other than the schedule, the additional work will have to be done by another labor gang as per
(6) If the quantityof work to bedoneas perthe scheduleis high, the work will have to be done at all locations
simultaneously with different gangs.
(7) During festivals like Holi, Raksha Bandhan, Janmashtami and Diwali, at least one labor gang will have to
be kept available.
Contractor’sSign Add.CityEngineer(WestZone)
AHMEDABAD MUNICLPAL CORPORATION
MAHANAGAR SEVA SADAN
Clause : 1 Contractor shall not employ any child having age 5 to 15 years as it is prohibited by Child Labour Prohibition and Regulation
Act 1986. Hon'ble Supreme Court has given certain guide lines and as per the guide lines. If child labour is employed on the site work,
the contractor shall have to deposit Rs. 20,000.00 (Rupees Tw enty thousand only) in the child labour welfare fund. If the employer
refuses to deposit then action will be taken for contempt of Supreme Court Judgement and also will be prosecuted by concerned
authority. Because of the breach of any provision of child labour prohibition and regulation Act 1986 by the Contractor & Municipal
Corporation becomes liable to pay any amount then the Municipal Corporation shall recover the said amount from the contractor.
Clause : 2 The Standing Committee has decided to deduct 1/2% amount from each running bill as per its Reso. No. 1783 Date 06--02-
97, but the Municipal Corporation Board has recently decided that the actual testing charge is taken and the remaining amount is
refundable at the time of final bill (As per Muni. Board Reso. No. 123 dated 25-02-97)
Clause : 3 Contractor has to follow prevailing Labour act and has to maintain labour register acordingly,and has to follow other
Clause : 4 Quantity taken in tender are tentative and may differ as per execution of work. No claim shall be entertain regarding
* MODIFICATION OF DOCUMENTS
Modification of specifications and correction/corrigendum in respect of the work if required will be made by A.M.C. The same shall
be placed on A.M.C website which may be downloaded by the tendrers enclosed along with the tender duly signed. These shall form
a part of tender. The tenderer shall not add or amend the text of any of the documents except in so far as may be necessary to
comply with any addendum.
* ADDENDAUM/CORRIGENDUM .
Addendum or corrigendum conveying any change or correction in respect of the work shall form the part of the contract documents.
The full consideration shall be given to such addendum or corrigendum or correction before submission tender duly filled in by the
contractor. Therefore, the contractor shall have to watch such addendum or corrigendum or correction published by A.M.C through
its website www.egovamc.com. Tenderes shall verify the number of addendum issued and enclose the same with the tender
documents,failing which the tender shall be liable for rejection and no any complaint in respect to this shall be entertained under any
CONTRACTOR'S SIGNATURE ADDL.CITY ENGINEER
& STAMP ( West Zone)
Tap a document below to read it instantly. You can also download everything as a ZIP if you prefer.
details.html
RAW_HTML
Tender No. 4.pdf
Download all tender documents and submit your bid