P/L Foothpath And repairing Foothpath Of CCRS Complains , Councilor Complaints , Morning Round And Light Department Excaveted Foothpath At Diff TP Roads And Colour Work On Footpath on TP Road in Stadium ward Of WZ (ARC)

Name of Work :- P/L Foothpath And repairing Foothpath Of CCRS Complains , Councilor

Complaints , Morning Round And Light Department Excaveted Foothpath At Diff TP Roads And Diff

area in Stadium ward Of WZ (ARC)

Name of Zone:West Zone

Sr. Quantity Item Rate Unit Amount

1 150.00 Excavation for foundation up to 1.5 mt. 127.13 Cmt

depth including sorting out stacking of

useful material & disposing of excavated

stuff up to 50 mt. lead loose or soft soil (As

per Building SOR 2015-16)

2 150.00 Conveyance charge of earth, lime, murrum, 52.42 Cmt

building rubbish,manual garbage, sludge,

excavated rock ,fly ash, aggregate of any

kind etc. comp.up to 5.0 Km. lead (Based

on Building SOR 2015-16, P-589 - Item

3 Extra rate over item of excavation of earth

for excavation of asphalt pavement / RCC

of thickness up to 0.20 meter including

demolishing the asphalt carpet, metal,s

oiling/cutting Reinforcement etc.comp. with

stacking the material as directed. (Based on

Previously approved rate by C E sir )

a 100.00 up to 0.20 meter thickness (By Manual) 70.40 Smt

b 100.00 0.20 to 0.30 meter (By any type of Breaker 176.00 Smt

Machine or R.C.C.Cutter machine including

cost of operator, fuel, & transportation etc

c 100.00 0.30 meter & above (By any type of 311.08 Smt

Breaker Machine or R.C.C.Cutter machine

including cost of operator, fuel, &

transportation etc complete.

4 250.00 Supplying and fixing of 300 mm-L x 150 350.89 Rmt

mm-B x 380 mm-H Kerb block for

Footpath in M-20 grade using 20 mm

nominal size black trap aggregate of

Sevaliya/Timba or equivalent quality for

pre-cast blocks, reasonably exposed finish/

formwork , mould with well equipped with

vibratory system for kerb stones of

approved design including curing, etc.

complete, including the cost of formwork

etc. complete. The rate shall also include

necessary cutting of asphalt, fixing the Kerb

stones in line and level on 5 cm thick sand

bedding with necessary equipments and

materials. The rate shall also include the

flush pointing in CM (1:3) for all joints of

the kerbstones. Filling of zari alone the

sides of the kerb stone fixed with

Bituminous concrete mixed in proper

position as directed by Engineer in change

to form a portable mixture. In any case

Gravel or such type of materials shall not be

allowed for production. a) Laying on 5 cm

thick Sand Bedding

5 1450.00 Providing and Laying of Rubber Moulded 501.60 Smt

Paver Block Grey/Coloured 60 mm thick,

M-35 Grade of any size ; shape (Usually

Uni-Paver Blocks) using black trap good

quality aggragate of 20 mm nominal size for

footpath, parking areas, service lanes

and other areas as mentioned in the

drawing / instruction of engineer in charge.

Cost includes formworks using rubber

mould, Rate providing and laying paver

blocks as per required grading and

specification. The paver block shall be

mechanically compacted. The work of

paving blocks shall be executed in line and

level by skill mason of flooring work only.

It should be laid in such a way that the no

cutting of the paver block to be necessary. if

cutting of paver block necessary then it

should be cut by machine only and carting.

The finished surface of the paver block shall

have resonably good, plain finished. Paver

blocks shall be compacted and shall be

relaid if necessary. Gravel or such type of

materials shall not be allowed for

production. Laying on 5cms thick sand

6 255.00 Provdg. & laying cement concrete 1:5:10 1802.24 Cmt

(1 cement : 5 coarse sand : 10 hand broken

stone aggregates 40 mm nominal size) and

curing complete excluding cost of form

7 Labour work for fixing any kind of paving

with cement pointing in CM 1:2, including

watering, ramming etc comp. as directed

a 1500.00 Laying on Sand bedding as per requirement 68.64 Smt

to fix the C.C.Block / Nibhada Stone in

b 200.00 For Water Table & Kerb on Sand bedding 30.80 Rmt

as per requirement to fix the C.C.Block /

Nibhada Stone in Line & Level.

8 300.00 Supplying and fixing Nimbhada ladi 37 to 233.20 Smt

50 mm thick for walk-way covering the

activity of excavation ramming Laying on

sand bedding as per requirement to fix the

Nibhada Stone in Line & Level with cement

pointing in cement mortar 1:2 etc complete

9 50.00 P/L brickbats sand concrete (1:2) of one 308.00 cmt

part of sand and two part of old brickbats

including spreading laying ramming

watering and consolidation etc complete as

10 Providing, laying, spreading and

compacting graded stone aggregate to wet

mix macadam specification including

premixing the Material with water at OMC

in mechanical mix plant carriage of mixed

Material by tipper to site, laying in uniform

layers in subbase / base course on well

prepared surface and compacting with

vibratory roller to achieve the desired

density as per MoRTH clause

100.00 (A) Supply of WMM 1708.13 Cmt

60.00 (B) Laying of WMM 31.25 Cmt

11 Repairing damaged M.H. incl. removing

damaged brick and repairing by masonry in

C.M. 1:5 and plaster in C.M. 1:3 and fixing

C.I. steps and M.H. and carting the same as

directed. (Drainage SOR 2015-16)

100.00 (A) up to 0.15 mt. (@ Two Coarse) 721.60 No.

50.00 (B) up to 0.35mt. (@ Four Coarse) 1144.00 No.

5.00 (C) up to 0.65 mt. (@ Seven Coarse) 1768.80 No

12 500.00 Labour work of fixing Kurb any design of 136.40 Rmt

central verge, (both side) footpath kurb,

items includes necessary excavation,

asphalt cutting of any thickness, erecting in

line and position and pointing with cement

mortar (1:3), watering, etc complete, filling

with zari along the side of the kurb, the

kurb stone fix prepared with bitumnious

top surface, as directed by engineer in

13 5000.00 Removing any kind of pavement incl 12.32 Smt

stacking of serviceble material disposal of

unserviceble material with 50 meter lead

Total Amount Rs.

Total Amount Rs.

Contractor'sSign Addl.C.E.

MobilNo:- (westzone)

AHMEDABADMUNICIPALCORPORATIONENGINEERDEPARTMENT

TECHNICALSPECIFICATION

Nameof Work :- v.Ítul mhœth vxuj Mxuzegb Jtuzobtk swœt swœt xe.ve.htuz vhle ngt< Vwxvt& hevuhekd fhJtlt <&t

vuJh çjtuf ltkFJtlt ftb ctc<

GeneralTechnicalSpecificationSection

FollowingtechnicalspecificationsshallbeapplicabletotherelevantitemsofBOQ

Earth work in cutting in all sorts of soil & murrum incldg.conveyaning ,breaking clods spreading the stuff as &

where dire. With in a lead of 50 mt. from end of cutting.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Conveyance charge of earth, lime, murrum, building rubbish, manure,

garbage, sludge, excavated rock, fly ash, aggregates of any kind Including

spreading & levelling etc. complete.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Extra rate over item of excavation of earth for excavation of asphaltpavement / RCC of thickness up to 0.20 meter

includingdemolishing the asphalt carpet, metal, soiling/cutting Reinforcement etc. comp. with stacking the material as

directed. (a) upto 0.20 meter thickness (By Manual)(b) 0.20 to 0.30 meter (By any type ofBreaker Machine or R.C.C.Cutter

machine includingcost of operator, fuel, & transportation etc complete.(c) 0.30 meter & above (By any type of Breaker

Machine or R.C.C.Cuttermachineincludingcostofoperator,fuel,&transportationetc complete.

TheItemshallbecarriedoutasperItemdescriptionandasperinstructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.

Therateincludesthecostofexcavationofbituminousmacadami.e.bituminouslayersonlylikeDBM,BCetcincludingthelabours,tools,equip

mentandallotherincidentalexpenses.NonBituminousSub-layer/Subbasearenotconsideredinthisitem.

WorkshallbecarriedoutmanuallyorbyMachineryaspersiterequirements.Themode

ofpaymentforthisitemshall beon Smt. Basis.

Supplying and fixing of 300 mm-L x 150 mm-B x 380 mm-H Kerb block for Footpath in M-20 grade using 20 mm nominal size black

trap aggregate of Sevaliya/Timba or equivalent quality for pre-cast blocks, reasonably exposed finish/ formwork , mould

with well equipped with vibratory system for kerb stones of approved design including curing, etc. complete, including the

cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level on

5 cm thick sand bedding with necessary equipments and materials. The rate shall also include the flush pointing in CM

(1:3) for all joints of the kerbstones. Filling of zari alone the sides of the kerb stone fixed with Bituminous concrete

mixed in proper position as directed by Engineer in change to form a portable mixture. In any case Gravel or such type of

materials shall not be allowed for production. a) Laying on 5 cm thick Sand Bedding .

Thespecifictionoffollowingmaterialsshallbeconformingwithspecificationmentionedforrelaventmaterial/itemsinGeneraltechnicalspe

cification for buildingworkofR&B DepartmentofGujarat.

Water shall conform to M-1

Graded stone aggregate 20 mm.nominal size to M-10

Contractor shall have to manufacture the blocks as per the dimensions given in the drawing. Specific machineries shall be used

tomanufacturetheprecastblocks.Thesemachineriesshouldbecompatibletoproduceblocksofrequiredstrengthanddimensions. The

machine shall contain hydraulic Press or advanced equipment to generate required compaction & Grade andfinish. Moulds/ Steel

Plates/ Dies of the machine shall be dimensionally checked & to be got approved before commencing theproduction. Contractor

shall prepare proper Drying Yard for keeping the blocks before curing. The drying yard shall be

levelledandcoveredsothatnoshrinkagecracksareformed.Contractorshallprepareadequatesizecuringpondtocuretheblocksfornotles

sthan21Days.Noothermeansofcuringshallbeallowed.ThetechnicalspecificationofconcreteshallconfirmtoIS456-2000. The concrete

mix is not required to be designed and only nominal mix as per IS: 456-2000 shall be followed. The proportionof the concrete mix

shall be 1:1.5:3 (1 cement: 1.5 coarse sand: 3 graded stone aggregate 20 mm. nominal size) by volume.Concrete work shall have

fairly exposed concrete surface or as specified in the item. The designation ordinary M-10, M-15, M-20,M-25 specified as per I.S.

corresponds approximately to 1:3:6, 1:2:4, 1:1.5:3 and 1:1:2 nominal mix of ordinary concrete, byvolume respectively. The

ingredients required for ordinary concrete containing one bag of cement of 50 Kg. by weight (0.0342m3.) for different

proportions of mix shall be as per IS 456-2000. The proportion of the aggregate for the kerb stone shall bemodified as per the

approval of the engineer-in-charge. The water cement ratios shall not be more than those specified as per IS.The cement of the

mix shall be increased, if the quantity of water in a mix has to be increased to overcome the difficulties ofplacement and

compaction so that the water cement ratio specified in the table is not exceeded. The maximum size of coarseaggregate shall be

as large as possible within the limits specified but in no case greater than 1/4th of the minimum thickness

ofthemember,providedthattheconcretecanbeplacedwithoutdifficultysoastosurroundallreinforcementthoroughlyandtofill the

corners of the form. For reinforced concrete work, coarse aggregates having a nominal size of 20 mm. are generallyconsidered

satisfactory. Admixture shall be used in concrete only with approval of the Engineer-in-charge based upon theevidence that with

the passage of time, neither the compressive strength of concrete is reduced nor are other requisite qualitiesofconcrete impaired

bythe useofsuch admixtures.

Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50 kg weight. The volume

ofone such bag can be taken as 0.0342 m3. Boxes of suitable sizes shall be used for measuring sand and aggregate. The size of

theboxes (internal)shall be 30cm.x30 cm.and38 cm.deep. While measuring the aggregate andsand,the boxshall be filledwithout

shaking ramming or hammering. The proportioning of sand shall be on the basis of its dry volume and in case of

dampsand;allowancesforbulkageshallbe made.

For all work, concrete shall be mixed in a mechanical mixer which along with other accessories shall be kept in first class

workingcondition and maintained throughout the construction. Measured quantity ofaggregate, sand, and cement required for

eachbatch shall be poured into the drum of the mechanical mixer while it is continuously running. After about half a minute of

dry-mixing, measured quantity of water required for each batch of concrete mix shall be added gradually and mixing continued

foranother one and a half minute. Mixing shall be continued till materials are uniformly distributed and uniform colour of the

entiremassisobtainedandeachindividualparticleofthecoarseaggregateshowscompletecoatingofmortarcontainingitsproportionate

amount of cement. In no case shall the mixingbe done for less than 2 minutes after all ingredients have been putinto the mixer.

Mixers which have been out of use for more than 30 minutes shall be thoroughly cleaned before putting in a newbatch. Unless

otherwise agreed to by the Engineer-in-charge, the first batch of concrete from the mixture shall contain only2/3rds of normal

quantityof coarse aggregate. Mixing plant shall be thoroughlycleanedbefore changingfrom one type ofcement toanother.

The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete shall

bedetermined by regular slump tests in accordance with IS: 1199-1959. The slump of 10 mm. to 25 mm. shall be adopted

whenvibratorsare used.

All Moulds shall be cleaned and made free from standing water, dust, snow, or ice immediately before placing of

concrete.Formwork/MetalMould forexposed concrete surface(Ifindicated):

Allthemouldsshallbecheckedforexactdimensionsoftheprecastblocks.Alltheedgesoftheprecastblocksshallconfirmthe

profile of the final drawing & edges/ curvatures of the moulds shall be checked accordingly. Moulds shall be regularly checked

forcorrectnessofdimensionsofBlocks, twists, bendsdueto handling, etc.Beforestartingevery dayswork.

Care shall be taken to set all form work/Mould in perfect line, level (or in required camber or slope as specified) and plumb.

Formwork/Mould propping shall be strong, rigid, and sturdy. The form work/Mouldshall be as per pattern & design shown

indrawings. Form work/Mould shall be done accurately and precisely so as to achieve neat, clean and smooth concrete surface,

inline, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall not be allowed. Before placing

concrete,forms shall be thoroughly cleaned off of all rust, dust, and loose materials. Colourless oil or grease of approved quality

shall beappliedbeforeplacingsteel.Alsotheformworkmaterialwillbeofwood/plywood/steeloranysortofsuchmaterial,as approved

by the Engineer-in-Charge and/or his authorized representative; so that all exposed concrete surfaces have uniformcolour.

Forallkindofexposedconcreteworkonlyonebrand(tobeapprovedbytheEngineer-incharge)ofcementshallbeused.

RemovalofMoulds:

Specific time shall be identified for removal of moulds, such that the concrete of the precast blocks shall gain strength

towithstand the stresses generated due to self weight and handling to drying yards without any deformation to shape/

dimensions/edges.

Sufficient time shall be given to the block after it is removed from the mould so that it can gain strength and dry in shade

toprevent anycracksdue to shrinkage. Thisshall be doneindryingyards.

Curingofblockshallbedoneonlyincuringpondandcuringshallbedoneforminimum14days.

Drying period after removing from pond & before delivery to site:Water should be drained of from the block before it is

actuallysent to the site. Time should be provided for proper draining of water which may be present in the block kept for curing

Precautionshallbetakenwhiletransportingoftheblocksto site.

Theblocksshouldbeloadedandunloadedwithduecaresoastoavoidgenerationofstressesleadingtobreakingofblock.Careshould be

taken toprevent the block from breakingduring transporting.

The pits of the size 150mm in width and required depth shall first be excavated, true to line and level. The relevant

specificationsof item A- 1 shall be followed for excavation work. The pits shall be filled with a layer of 50mm. thick sand bedding.

The curbsthen shall be placed in position of which 50mm. shall be below road. Care should be taken to maintain proper line and

level.Thejointsbetween thekerbsshallbepointed withC.M.1:2and curedforminimumsevendays.

Samplingandtestingofconcrete:

Samples from fresh concrete shall be taken as per IS : 1199-1959 and cubes shall be made, curedand tested at 7 days or

daysas per requirements in accordance with IS : 516-1959. A random sampling procedure shall be adopted to ensure that

eachconcrete batch shall have a reasonable chance of being tested i.e. the sampling should be spread over the entire period

ofconcretingandcoverallmixing units.

At least 1 sample shall be taken from each shift. Ten test specimens shall be made from each sample, 5 for testing at 7 days,

andthe remaining 5 at 28 days. The samples of concrete shall be taken on each day of the concreting as per above frequency.

Thenumber of specimens may be suitably increased as deemed necessary by the Engineer-in-charge when procedure of tests

givenabove reveals a poor quality of concrete and in other special cases. The average strength of the group of cubes cast for each

dayshall not be less than the specified cube strength of 200 Kg/cm2 at 28 days. 20% of the cubes cast for each day may have

valueless than the specified strength provided the lowest value is not less than 85% of the specified strength. If the concrete

made inaccordance with the proportions given for a particular grade, does not yield the specified strength, such concrete shall

beclassified as belonging to the appropriate lower grade. Concrete made in accordance with the proportions given for a

particulargrade shall not,however,be placedinahighergrade onthe ground thatthe teststrengthare higherthanthe

minimumspecified. If rock pockets/honeycombs in the opinion of Engineer-in-charge are of such an extent or character so as to

affect thestrength of the structure,materially or toendanger the life of the steel reinforcement, he may declare the concrete

defectiveand requirethe removalandreplacement oftheportionofthe structureaffected.

PrecastKerbStones:

The relevant specifications of concreting as per item above shall be followed except that work shall be carried out for

precastconcrete kerb stones as specified in the item. All Precast members shall be cast at workshop. Sufficient curing shall be

donebefore placement of the samethe method of transporting and placing the precast members shall be as approved by

theEngineer-in-charge. Members shall be so transported that no breakage or undue stresses are induced in them. If required,

allmembers shall have a key provided on both the faces i.e top and bottom surfaces, of adequate size so as to fill the same

withconcrete while laying. The function of this key is to avoid the leakage through the joint between the precast member and

thememberonwhichit islaid.

ModeofMeasurementsandPayment:

Therate shallinclude costof formworkandcost ofreinforcement. Thevolumeoccupiedbyreinforcement shallnot

bedeductedfromR.C.C.work.

The rate shall be for a unit of Rmt.

Providing and Laying of Rubber Moulded Paver Block Grey/Coloured 60 mm thick, M-35 Grade of any size ; shape (Usually Uni-

Paver Blocks) using black trap good quality aggragate of 20 mm nominal size for footpath, parking areas, service lanes

andother areas as mentioned in the drawing / instruction of Engineer-in-Charge and/or his authorized representative.

Costincludes formworks using rubber mould, Rate providing and laying paver blocks as per required grading and specification.

Thepaver block shall be mechanically compacted. The work of paving blocks shall be executed in line and level by skill mason

offlooring work only. It should be laid in such a way that the no cutting of the paver block to be necessary. if cutting of

paverblock necessary then it should be cut by machine only and carting. The finished surface of the paver block shall have

resonablygood, plain finished. Paver blocks shall be compacted and shall be relaid if necessary. Gravel or such type of

materials shall notbe allowedfor production.Layingon50mmthick sandbedding.

• Layingon50mmthicksandbedding.

Excavation and compaction up to 300 mm in height for footpath paving in all sorts of soil murrum includingsorting

outsandstackingofusefulmaterialsstuffupto 50mt.

The scope of work includes manufacturing, supplying, and lying of precast paver blocks at various Retail outlets. The

workincludes: Verification of the existing site condition and advising our project in charge to lay suitable base course if

required.Contractors are required to satisfy themselves with quality of sub grade, sub-base course before the paver blocks are

laid andsuggest strengthening ifrequired.

Clearing the site by removing all obstacles such as stones, debris etc. for laying of paver blocks. Manufacturing of paver blocks

inyour plant as per requirements in technical specification enclosed. Supplying of paver blocks at site, including handling at

Laying of paver blocks at site as per requirement in technical specification on 50 mm thick sand bedding, within shortest

possibletime the site is public place hence care should be taken to ensure that the routine activities should not be disturbed. The

job oflayingmayrequired tobe carried outduringnightalso.

TestingofpaverblocksshallthroughreputedGovt./NonGovt.Testhouseonlyandsubmissionoftestresultsasperrequirements in

Technical Specifications. AMC reserves the right to carryout test at random. Cost for such tests to be borne byparty. The

contractor shall guarantee that all material and components designed, fabricated, supplied, and laid by him shall befree from any

type of defect due to faulty material and/or workmanship/erection for a period of One year from the date ofcompletion

ofwork.However,thecontractorone year'sshallrender freemaintenance.

TECHNICALSPECIFICATIONS:

PaverBlockManufacturingFacilities:

ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:

ConcreteBlockmakingMachines:

The machine shouldbe capable of producinghighqualityPaverBlocks byobtaininghighlevelof compactionbyapplication of

hydraulic compaction and also by high intensity vibration to the moulds. The machine should haveautomaticcontrol

foruniformityinstrength.

ConcreteBatching&MixingPlant:(Notessential)

The concrete Mix Design should be followed for each batch of materials. The concrete ingredient should be mixed

inconcrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The plant should equipped with

automaticcontrol panel formaintaining watercement ratiofrombatch to batch to obtain concrete of uniform quality

andstrength.Theplantshouldbeequippedwithadequatemechanismformechanizedloadingofrawmaterialsintomixer

andconveyorbeltfortransportationofconcretefrommixertoconcreteblockmakingmachinetomaintainqualityofwet cement.

Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.

Laboratory(Desirablebutnotessential):

The testing equipment should have required in the Laboratory as perthe

following:ACompression testingmachineofadequate capacity.

Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.

Systematic record of test results of various paver blocks manufactured in the

factory.ConcreteMixDesignfor variousgradeofconcreteusedformakingofpaverblocks.

SpecificationsForColouredPaverBlocks:

Coloured concrete paver blocks shall be manufactured as per attached specifications using or equivalent

approvedcolourPigmentof“BAYER”Make“BAYFERROXIRONOXIDEPIGMENTS”withminimumcolourpigmentof3%byweight

of cement. The colour shade shall be “RED” as selected by AMC before commencement of the work. White cement

shallbe used for colored pavers to obtain the desired colour shade. The job also includes providing 50 mm thick sand

beddingto matchthe shadeofthe paverblock.

Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingofthe

Allothertechnicalspecifications&Procedurefortesting,laying&samplingofcolouredpaverswillbeasperattachment.

PaversBlockCharacteristics:

The concrete pavers should have perpendicularities after release from the mould and the same should be retained

untilthe laying. The surface should be reasonably smooth and of anti skid and anti glare type. The paver should have

uniformchamfers to facilitate easy drainage surface run off. The pavers should have uniform interlocking space of 2mm

to 3mmto ensure compacted sand filling after vibration on the paver Surface. The concrete mix design should be

followed foreach batch of materials separately and automatic batching plant is to be used to achieve uniformity in

strength andquality.The pavers shall be manufactured in single layer only. Skilled labour should be employed for laying

blocks toensure line and level of laying, desired shape of the surface and adequate compaction of the sand in the joints.

Thepavers shall be of cement gray colour without any pigment & for coloured pavers refer “specifications for

colouredpave`” The pavers are to be skirted all round with kerbing using solid concrete blocks of size 150mm X 250mm X

380mm.The kerbing should be embedded for 100mm depth. The concrete used for kerbing shall be cured properly for

PaverBlockDimensions:

Shape Unipaver,IshapeordirectedbyAddl.C.E.

Chamfer 4mmto6mmalongtopedges

Colour Naturalcementgreycolourwithoutuseofanypigment.

Forcolouredpaversrefer“specificationsforcolouredpavers”

DimensionalTolerance (+/-)2mmforlength&width,

(+/-)3mmforHeight(Thickness)

TestingofPaverBlocks:

SR.NO *TEST AverageValues Frequency

1. CompressiveStrength Min.35N/Sqmmfor60mm 250Smt/1Test

2. FlexuralStrength Minimum4.5N/Sqmm

3. AbrasionResistance Maximum1.5

4. WaterAbsorption Maximum5.80%

*Samplingandtestingprocedureasperenclosedspecifications

SamplingandTestingProcedureforPaverBlocks

INTERNAL–Averageofminimum3samplesper 5000Blocks.

SamplingforTesting

SamplingofPaverblocks.

Methodofsampling :

Before laying paver blocks, each designated section comprising not more than 50000 blocks, shall be divided into

tenapproximately equalgroups. Threeblocksshallbe drawnfrom each group.

Markingandidentification:

All samples shall be clearly marked at the time of sampling in such a way that the designated section of part thereof,

andtheconsignmentrepresentedbythesample,areclearlydefined.

The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving intransit. Protect

the paving from damage and contamination until they have been tested. The testing shall be carried assoon as possible, after the

sample has been taken. As soon as practicable after sampling. The samples shall be stored inwaterat20degreeC5 degreeC for24

hourspriortotesting.

The item is to be executed as per instructions and to the entire satisfaction of Engineer-in-Charge and/or his

authorizedrepresentativeusingRubbermould andTablevibratorforKerb instead ofmechanicalpresssystem.

Extra rate for excavation of asphalt payment of any thickness including demolishing the asphalt carpet, metal, soling etc.complete

with stacking the materials as directed. The road surface of asphalt shall carefully be opened to full width asdirected by the

Engineer-in-Chargeand/or hisauthorizedrepresentative.

Excavationareashallbeproperlyidentifiedandmarkedinrectangularshape.Theroadcrustshallbeopeneduptoentire depth i.e. including

soling. All the materials shall be separately deposited in such a way and in places as may bedetermined by the Engineer-in-Charge

and/or his authorized representative. In case rubble not being so deposited orbeing mixed up with the excavated materials will

not be allowed for refilling. The cost of materials shall be charged fromthecontractor.The decision oftheC.E.shall befinal and

bindingtothecontract

For detailed specification for Laying of Paver Block on sand bedding, refer R & B Department booklet for

GeneralTechnicalSpecificationforbuilding works.

Therate shallbefor aunitofSMT

Providing and laying cement concrete 1:5:10 (1- Cement : 5- fine sand : 10- graded brick bat aggregates 40mm nominal

size)and curingcomplete.

Before starting the concrete the bed of the foundations trenches shall be cleared of all loose materials and watered and

rammedas directed. The proportion of cement, sand and hand broken stone aggregates shall be one part of cement, 5 parts of

coarsesand, 10parts of hand broken stone aggregates and shall so measured by volume. The concrete shall be mixed in a

mechanicalmixer at the site of work. Hand mixing may however be allowed for smaller quantity of work if approved by the

Engineer-incharge.WhenhandmixingispermittedbytheEngineer-

inchargeincaseofbreakdownofmachinery’sandintheinterestofthe work. itshall be carriedout on a water tight platform and care

shall be taken to ensure that mixing is continued until themass is uniform in colour and consistency. The quantity of water

shall be sufficient to produce a dense concrete of requiredworkability for the purpose. The concrete shall be handled from the

place of mixing to the final position in not more than 15minutes by the method as directed and shall be placed into its final

position, compacted and finished within 30 minutes of mixingwith water i.e. before the setting commences. The concrete shall

be laid in layers of 15 cms. to 20 cms. The concrete shall berammed with heavy iron rammers and rapidly to get the required

compaction and to allow all the gaps to be filled with mortar.After the final set, the concrete shall be kept continuously wet, if

required by pounding for a period of not less than 7 days fromthe date of placement The concrete shall be measured for its

length breadth and depth, limiting dimensions to those specified onplan or asdirected.

ModeofmeasurementsshallbeonCMTbasis

Labour work for fixing interlocking blocks / any kind of pavement on up to 50 mm th sand bedding, levelling, watering and

fixing in line & level as well cleaning the site etc.comp. as directed.

Therateshallbe foraunit of SMT BASIS.

Supplying and fixing Nimbhada ladi 37 to 50 mm thick for walk-way covering the activity of excavation ramming Laying on sand

bedding as per requirement to fix the Nibhada Stone in Line & Level with cement pointing in cement mortar 1:2 etc complete as

Modeofmeasurementsshall beon smt.basis.

P/L brickbats sand concrete (1:2) of one part of sand and two part of old brickbats including spreading laying ramming watering

and consolidation etc complete as directed.

Modeofmeasurementsshall beon cmt.basis.

Providing, laying, spreading and compacting graded stone aggregate to wet mix macadam specification including premixing the

Material with water at OMC in mechanical mix plant carriage of mixed Material by tipper to site, laying in uniform layers in sub-

base / base course on well prepared surface and compacting with vibratory roller to achieve the desired density as per Codal

Production & Supply of WMM to site of

worksLayingof WMM

This work shall consist of laying and compacting clean, crushed, graded aggregate and granular material, premixed with water,

toa dense mass on a prepared sub-grade/sub- base/ base or existing pavement as the case may be in accordance with

therequirements of these Specifications. The material shall be laid in one or more layers as necessary to lines, grades and cross-

sectionsshownon the approved drawingsorasdirected bytheEngineer.

The thickness of a single compacted Wet Mix Macadam layer shall not be less than 75 mm. When vibrating or other

approvedtypes of compacting equipment are used, the compacteddepth of a single layer of the sub-base coursemay be upto

mmwith the approval ofthe Engineer.

PhysicalRequirements

Coarseaggregatesshallbecrushedstone.TheaggregatesshallconformtothephysicalrequirementssetforthinTable19-1.

Sevaliya/Timba/Ankodiyaspecialaggregateisonlyacceptable.

Ifthewaterabsorptionvalueofthecoarseaggregateisgreaterthan2percent,thesoundnesstestshallbecarriedoutonthematerialdelivered

to site asperIS:2386 (Part-5).

Table19-1:PhysicalRequirementsofCoarseAggregatesforWetMixMacadamforSub-base/BaseCourses

S.No. Test TestMethod Requirements

1. LosAngelesAbrasionvalueorA IS:2386(Part-4) 40percent(Max.)

ggregateImpact value

IS:2386(Part- 30percent(Max.)

2. CombinedFlakinessandElongationindices(To IS:2386(Part-1) 35percent(Max.)*

* To determine this combined proportion, the flaky stone from a representative sample should first beseparated out. Flakiness index is weight of flakystone

metal divided by weight of stone sample. Only the elongated particles be separated out from the remaining (non-flaky) stone metal. Elongation index

isweightofelongatedparticlesdividedbytotalnon-flakyparticles.Thevaluesofflakinessindexandelongationindexsofoundareaddedup

GradingRequirements

TheaggregatesshallconformtothegradinggiveninTable19-2.

Table19-2:GradingRequirementsofAggregatesforWetMixMacadam

ISSieveDesignation PercentbyweightpassingtheISSieve

Materialfinerthan425 micronshallhavePlasticityIndex(PI)notexceeding6.

The final gradation approved within these limits shall be graded from coarse to fine and shall not vary from the low limit on

onesievetothehighlimit ontheadjacentsieve orviceversa.

Construction Operations:-

Preparation ofBase

The surface of the sub-grade/sub-base/base toreceive the Wetmixmacadam courseshall be preparedtothe specifiedgradeand

camber and cleaned of dust, dirt and other extraneous material. Any ruts or soft yielding places shall be corrected in anapproved

manner and rolleduntil firmsurface isobtained.

Where the Wet mix macadam is to be laid on an existing metalled road, damaged area including depressions and potholes

shallbe repaired and made good with the suitable material. The existing surface shall be scarified and re-shaped to the required

gradeand camberbeforespreadingthe coarseaggregate forWetmixmacadam.

PreparationofMix

WetMixMacadamshouldbepreparedinanapprovedmixingplantofsuitablecapacityhavingprovisionforcontrolledadditionof water

and forced/positive mixing arrangement like pugmill or pan type mixer of concrete batching plant.For small quantity ofwet

mixwork,theEngineermay permitthemixingtobedone in concrete mixers.

Quantityof watershouldnotvaryfrom OMC determinedas perIS : 2720 (partVIII)bymore thanagreedlimit.The mixedmaterialshould

be uniformly wetand nosegregation should be permitted.

Immediately after mixing, the aggregates shall be spread uniformly and evenly upon the prepared subgrade/sub-base/base

inrequired quantities. In no case should these be dumped in heaps directly on the area where these are to be laid nor shall

theirhaulingover a partlycompleted stretchbe permitted.

The mix may be spread either by a paver finisher or motor grader or as per instruction of Engineer-in-Charge and/or

hisauthorized representative. For portions where mechanical means cannot be used, manual means as approved by the

Engineershall be used.The motor grader shall be capable of spreading the material uniformly all over the surface. Its blade shall

havehydrauliccontrolsuitableforinitialadjustmentsandmaintainingthesame soasto achievethespecifiedslopeand grade.

Thepaver finishershallbeself-propelled,havingthefollowingfeatures:

(i) Loadinghoppersandsuitabledistributionmechanism

screedshallhavetampingandvibratingarrangementforinitialcompactiontothelayerasitisspreadwithoutruttingorotherwisemarringth

e surface profile.

(iii) Thepavershallbeequippedwithnecessarycontrol mechanismsoas toensurethatthefinishedsurfaceisfreefrom surfaceblemishes.

The surface of the aggregate shall be carefullycheckedwithtemplates andall high or low sports remediedbyremoving oradding

aggregate as may be required. The layer may be tested by depth blocks during construction. No segregation of layer

andfineparticlesshouldbeallowed.Theaggregatesasspreadshouldbeofuniformgradationwithnopocketsoffinematerials.

Afterthemixhasbeenlaidtotherequiredthickness,gradeandcrossfall/camberthesameshallbeuniformlycompacted,tothefulldepthwith

suitableroller.Ifthethicknessofsinglecompactedlayerdoesnotexceed100mm,smoothwheelrollerof80to

100 kN weight may be used. For a compacted single layer upto 200 mm, the compaction shall be done with the help of

vibratoryrollerofminimum staticweightof80to100kNorequivalentcapacityroller.Thespeedoftherollershallnotexceed5km/h.

In portions having unidirectional cross fall/superelevation, rolling shall commence from the lower edge and progress

graduallytowards the upper edge. Thereafter, roller should progress parallel to the centre line of the road, uniformly over-lapping

eachpreceding trackbyatleastone thirdwidthuntil theentire surfacehas beenrolled.Alternate trips of the rollershallbeterminated

instopsatleast 1m away from any preceding stop.

In portions in camber, rolling should begin at the edge with the roller running forward and backward until the edges have

beenfirmly compacted. The roller shall then progress gradually towards the centre parallel to the centre line of the road

uniformlyoverlappingeach oftheprecedingtrack by at least one-third width untiltheentiresurfacehasbeen rolled.

Any displacement occurring as a result of reversing of the direction of a roller or from any other cause shall be corrected at

onceasspecifiedand/or removedandmade good.

Along forms, kerbs, walls or other places not accessible to the roller, the mixture shall be thoroughly compacted with

mechanicaltampers or a plate compactor. Skin patching of an area without scarifying the surface to permit proper bonding of the

addedmaterialshall notbepermitted.

Rolling should not be done when the subgrade is soft or yielding or when it causes a wave-like motion in the sub-

base/basecourse or subgrade. If irregularities develop during rolling which exceed 12 mm when tested with a 3 metre straight

edge, thesurface should be loosened and premixed material added or removed as required before rolling again so as to achieve a

uniformsurfaceconformingtothedesiredgradeandcrossfall.Innocaseshouldtheuseofunmixedmaterialbepermittedtomakeupthe

depressions.Rolling shall be continued till the density achieved is at least 98 per cent of the maximum dry density for

thematerialasdetermined by the method outlinedin IS :2720(Part-8).

Aftercompletion,thesurfaceofanyfinishedlayershallbewell-closed,freefrommovementundercompactionequipmentorany

compaction planes, ridges, cracks and loose material. All loose, segregated or otherwise defective areas shall be made goodto

the fullthicknessofthelayer andrecompacted.

Settinganddrying:

Afterfinalcompactionofwet mixmacadamcourse,theroadshallbeallowedtodryfor24hours.

OpeningtoTraffic

Preferably no vehicular traffic of any kind should be allowed on the finished wet mix macadam surface till it has dried and

thewearingcourse laid.

Surface Finish and Quality Control of

WorkSurface evenness:

ThesurfacefinishofconstructionshallconformtotherequirementsofClauseinItemNo.16&17&18.

Qualitycontrol:

ControlonthequalityofmaterialsandworksshallbeexercisedbytheEngineerasperTable19-3.

Table19-3:TestandFrequencyforMaterialsforWetMixMacadam

Type Test Frequency ISCode

ofConstructi (Asper CircularNo.66)

Wet Gradation Onetestper200Cu.m. IS:2386,Part-I-1963

MixMacada AggregateImpactValue Onetestper1000Cu.m. IS:2386,Part-IV

Combined Flakiness Onetestper500Cu.m. IS:2386,Part-I

andElongationIndices

Atterberg Limits of portion Onetestper200Cu.m. IS:2720,Part-V

ofaggregatespassing

Densityofcompactedlayer Onesetofthreetestsper IS:2720,Part-VIII

RectificationofSurfaceIrregularity

Where the surface irregularity of the wet mix macadam course exceeds the permissible tolerances or where the course

isotherwise defective due to subgrade soil getting mixed with the aggregates, the full thickness of the layer shall be scarified

overthe affected area, reshaped with added premixed material or removed and replaced with fresh premixed material as

applicableand recompacted. The area treated in the aforesaid manner shall not be less than 5 m long and 2 m wide. In no case

shalldepressionsbefilledup withunmixed andungraded materialor fines.

ArrangementforTraffic

Duringtheperiodofconstruction,arrangementsforthetrafficshallbeprovided.TheContractorshalltakeallnecessarymeasures for the

safety of traffic during construction and provide, erect and maintain such barricades, including signs, marking,flags, lightsand

flagmenasper instruction oftheEngineer-in-charge.

MeasurementsforPayment

Therateshallbe foraunit ofonecubic meter.

Repairing damaged M.H. and rasing M.H. up to road level incl. removing damaged brick work and repairing by brick masonry in

C.M. 1:5 and plaster in C.M. 1:3 and fixing C.I. steps and existing MH sheet cover, removing the debris from MH and carting the

MeasurementsforPayment

The rate shall be for a unit of one cubic meter.

Labour work of fixing kurb any design of central verge, (both side) footpath kurb, items includes necessary excavation,

asphaltcutting of any thickness, erecting in line and position and pointing with cement mortar (1:3), watering, etc complete,

fillingwithzarialongthesideofthekurb,thekurbstonefixpreparedwithbitumnioustopsurface,asdirectedbyengineerincharge.

Work shall be carried out as per item description including cost of all labour and materials etc. complete as

directed.General standardpracticeof layingof paverblockis applicable.

ThemeasurementsshallbeonRMT basis.

Removing any kind of pavement incl stacking of serviceble material disposal of unserviceble material with 50 meter lead and lift.

Therate shallbefor aunitofSMT

Applying Priming Coat New Steel and Other any surface after and incl. Preparing the surface by / thoroughly cleaning, oil

grease, dirt and other foreign matter & Scoured with brushnes fine steel wood scrapers & Sand paper with ready mixed

paint brushing red lead.

Mode of measurement

Measurement shall be paid by Smt. basis.

Painting Two Coats on divider and footpath curb surface / new concrete surface (Painting two coats after filling the surfac

with synthetic enamel paint in all shades on new plastered concrete surfaces )

Mode of measurement

Measurement shall be paid by Smt. basis.

Finishing Wall with weather proof exterior emulsion paint on wall surface (two coats) to give an required shape even

thoroughly brushing the surface to remove all dirt, and remains of loose powdered materials etc, complete.

Mode of measurement

Measurement shall be paid by Smt. basis.

Painting one coats (excl. priming coat) on peviously painted steel & other Metal surfacer with enamel paint, brushing,

interior to give an even shade incl. cleaning the surface of all dirt, dust and other foreign matter..( Building

SOR - 2015-16 Ch-19, Item No.19.11 Page no.211)

Mode of measurement

Measurement shall be paid by Smt. basis.

White Washingwith lime on wall surface ( two cats) to give an even shade including thoroughly booming the surface to

remove all dirt , dust , mortar drops and other foreign matter.

Mode of measurement

Measurement shall be paid by Smt. basis.

Pre cast concrete kerb Providing and fixing M25 Grade of concrete precast exposed / Fair finish / texture finish kerb stones of

approved make as per approved sample of any size and any type. Kerbs shall be fixed on the foundation prepared as per

approved design. The rate shall also include for erecting and fixing the pieces in position for complete kerb system with

chamfered type of kerbs including necessary accessories of kerb like radius kerbs, angles and quadrant kerbs, droplet kerbs etc.

complete as per drawing. Kerb shall be fixed as paper joint without any jointing material. However cement mortar shall be

provided at the backside of kerb stone joint. (Sample must be approved) Cost of excavation, cutting , base , side filling shall

includes as directed engineer - incharge in above item description as per BOQ (b) 375 mm high Footpath

(1) Water shall conform to M-1.

(2) Cement shall conform to M-3.

(3) Sand shall conform to M-6.

(4) Stone aggregate shall conform to M-12

(5) Pre cast kerb shall be of approved make and as per approved sample.

1.0 Workmanship :

1.1 2.1 All Precast exposed/ fare finish/ texture finish kerb stones shall be of approved make.Sufficient curing shall be done

before placement of the same.

2.2 The method of transporting and placing the precast members shall be as approved by theArchitect and Engineer-in charge.

Members shall be so transported that no breakage orundue stresses are induced in them.

2.3 The pits of the size 0.15 M in width and 0.23 M. in depth or as per site condition shall first be excavated, true to line and

level. The specifications for excavation shall be followed as per relevant item.

2.4 The pits shall be filled with a layer of 0.15 M. thick lean concrete M15. The kerbs shall be laid on existing PCC base in true

line and plumb. The specifications for PCC work shall be followed as per relevant item.

2.5 The rate shall also include for erecting and fixing the pieces in position for complete Kerb systems with Chamfered type of

kerbs including all type of necessary accessories of kerb like Radius Kerbs, Angles and Quadrant Kerbs, inlet kerb etc complete as

per drawing. The rate shall also include the flush pointing in CM (1:2) for all joints of the kerb stones.

3.0 Mode of Measurement & Payment:

3.1 The rate shall include the cost of material and labour for fixing the kerb system including laying, jointing and finishing but

excluding the cost of excavation, bitumen cutting, base PCC, zari filling with bitumen material

3.2 The Measurement of the item shall be in Rmt basis.

Paver Block Providing and laying shot blasted Non - interlocking, Paver blocks of specified thickness, size, grade of concrete and

colour machine made and blasting by automatic shot blasting machine and high density of as per approved sample of approved

make for footpath, parking areas, service lanes,cross over and other areas as mentioned in the drawing. Including providing and

laying 50 mm thick averave bedding layer of coarse sand below paver block as per required grading and specification. Laid paver

block shall be mechanically compacted. The work of the paving blocks shall be executed in line and level by skilled mason of

flooring work only. Small size of paver block with same specification shall be used at residue or at end. It should be laid in such a

way that the no cutting of the paver block to be necessary. If cutting of paver block shall be required , than cut by machine only

and laying to be done by skilled flooring mason. The finished surface of the paver block shall have coarse sand Texture Finish.

Pave blocks shall be compacted and shall be re-laid if necessary. Actual laid area shall be measured and paid without any

wastage. (A) 60 mm thick M-35 grade Grey Paver block of size 200mm x 200mm.

The Item shall be carried as per Item Description in tender document and as Per prevailing latest IS & IRC Code & Genral

Specification booklet and As per instruction of Engineer-in-Charge and/or his authorized representative. The mode of payment

for this item shall be on Smt. Basis

I HAVE ALSO GONE THROUGH TECHNICAL SPECIFICATIONS FOR THE ITEMS (AS PER STANDARD P.W.D. TECHNICAL

SPECIFICATION FOR THE ITEMS AND ALSO I HAVE THE BOOK OF THE SAME) AND AGREE TO ABIDE BY THEM.

IN CASE OF WHERE IS NO TECHNICAL SPECIFICATION FOR THE ANY ITEMS AVAILABLE, SPECIFICATION GIVEN BY THE

ENGINEER-IN-CHARGE SHALL BE FOLLOWED AND FOR THE SAME I AGREE TO ABIDE BY THEM.

Seal and Signature of the Bidder Add.City Engineer (WestZone)

Amdavad Municipal Corporation

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

bntldh muJtmœl – œrûtK vrùbÍtul

vrùb Ítul Ítulj ytuVem,

1. Wvhtuf< xuLzhtu su <u Jdobtk btLg hSMx[uNl ^htJ<t ftuLx[tfxh©eytuyu ChJt.

2. xuLzhle rlg< xuLzh Ve <&t R.yub.ze. ck^ fJhbtkk Wvh lt mhltbu ÁcÁ / hSMxh yu.ze./ MvezvtuMx/ fwhegh&e rlg< mbgbtk btufjJtlt hnuNu.

3. ftuLx[tfxh©eytuyu xuLzhle mt&u BGþrlrmvj btLg hSMx[uNlle/ dJobuLx hSMx[uNlle ftuve, (xuLzh ftuve <&t yLg vwhtJt mt&u) yawf mtbuj

fhJtle hnuNu ylu fJh Wvh xuLzh lkch <&t ftuLxufx lkch sYh MvÐ œNtoJJtltu hnuNu.ck^ fhJh Wvh xuLzh ltuxem lkch, xuLzh lkch, ftblwk ltb

<&t, ftuLx[[tfxhle mkM&tlwk ltb <&t ftuLxufx lkch yJ~g œNtoJJtlt hnuNu. ftuLx[tfxhtuyu xuuLzhbt cukfl wltb, Ft<t lkch, btRfh lkch ylu

mhltb wMvÐ yûthtubtk jFJw.

4. xuLzh Ve vu ytuzoh / zebtLz z[tVx&e aqfJJtlehnuNu. œhuf xuLzh œeX yjd xuLzh xuLzhVe ChJtle hnuNu.

5. ytuAe hfble xuLzh Ve, R.yub.ze. fu xuLzh Ve, R.yub.ze. ÂJltlt xuLzhtu hœct<j (fuLmj) dKtNu.

6. xuLzh mt&u BþfJtbtk ytJ<e yluoMxble, xuLzhle hfblt 1% «btKu cukf duhLxe / zebtLz z[tVx / vu ytuzoh / jtufj btRfh auf&e s MJefthJtbtk

ytJNu. œhuf xuLzh œeX yjd R.yub.ze. ChJtle hnuNu. R.yub.ze. hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf,

rzbtLz z[tVx, vu ytuzoh fu cukf duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu R.yub.ze.le hfb btºt rzbtLz z[tVx, vu

ytuzoh fu ckuf duhkxelt MJYvbtk ytvJtle hnuNu.

7. cukf duhuLxe btºt ybœtJtœ Nnuhle s MJefthJtbtk ytJNu.

8. xuLzh Ve <&t R.yub.ze.le hfblt ze.ze./ aufle vtA¤ ftuLx[tfxh©eyu vtu<tle mkM&tlwk ltb <&t btuctRj lkch yJ~g jFJtltu hnuNu. ftuLx[t¾xhu

vtu<tle mkkM&tlt auf <&t ze.ze. xuLzh R~gw &gt <theF ctœlt s ytvJt.

9. Nh<e xuLzhtu hœ ct<j dKtNu.

10. stu xuLzhbtk MvÐ WÕjuF fhtguj ntug <tu atubtmtlu fthKu Ft<tfeg MËalt yLJgu ßgthu ßgthu ftb ck^ htFJtLþk &tg <u mbglu ftble BþÆ<btk bshu

ytvJtbtk ytJNu. vhkðþ yt yLJgu ftuE CtJ J^thtu ytvJtbtk ytJNu lne. sule ltuk^ >huf xuLzhh ujuJe.

11. xuuLzhtu ftuEvK fthK ytÃgt rmJtg MJefthJt fu lrnk MJefthJt <ule mkÃËKo m•tt BGþrlrmvj frbNlh©ele hnuNu.

12. xuLzhbtk stu ftuR mwDtht JDtht ntug <tu <u ykd xuLzh Ch<t vnujt AuÕju ÂœJmu rlg< JucmtRx y&Jt fauheyu sYhe <vtm fhelu s xuLzh btufjJw.

13. mefgtuhexe zevtuÍex/ vVtuboLm duhuLxele hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf, rzbtLz z[tVx, vu ytuzoh fu cukf

duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu mefgtuhexe zevtuÍex/ vhVtuboLm duhkxele hfb btºt rzbtLz z[tVx, vu ytu zoh

fu ckufduhkxelt MJYvbtk ytvJtle hnuNu.

14. ytuljtRl yul-«tufgwh JucmtRx vh&e ChJtlt &<t xuLzhbtk ftuLx[tfxh/ yusLmeyu xuLzhle ntzo ftuvebtk CtJ Cgto Jdhle mne mefft fhe

mcbex fhJtle hnuNu. stu <ubtk CtJ Chuj nNu <tu <uJt xuLzh hœ fhJtbtk ytJNu.

15. dwsht< mhfth ©b,ftuiNÕg ylu htusdth rJCtd îtht XhtJ ¢btf:LED/WRT/e-file/11/2024/0293/M2 mraJtjg ,dtk^eldh

<t.15.02.24 lt XhtJ v{btKu yusLme/¢tuLx[fxhtulu îtht ©bgtude ftgœtle studJtR vhevqKo &tg <u mwrlµ< fhJtlwk hnNu.

16. mœh xuLzhbtk ” GST rl<e rlgb bwsc jtdw vzNu ” <u bwsc dK<he fhe xuLzhtu ChJtlt hnuNu.

zebtLz z[tVx / auf “BgwÂlÂmvj fÂb§h©e, ybœtJtœ” lt ltbltu fZtJJtu.

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

yu.yth.me. xuLzh- Nh<tu

1. yu.yth.me. xuLzhbtk Jfoytuzh ytÃgt ctœ ftb NY fhJtle mbgbgtoœtbtk ftuLx[tfxh îtht ftb NY fhJtle òK fgto ctœ

24 fjtflt ftb NY lrn fhJtbtk ytJu <tu yLg ftuLx[tfxh vtmu btfuox hux&e ftuLx[tfxhlt Faou ylu stuFbu ftbdehe

fhtJJtbtk ytJNu.

2. ftuLx[tfxhlu Jfoytuzoh ytÃgt ctœ yu.yth.me. «fthlkw xuLzh ntuR ftble sYhegt< bwsc xujeVtulef òK fhe su <u ftb NY

fhJt fnuJtbtk ytJNu ylu su ftble òK fgtolt 24 fjtfbtk NY fhJtbtk lrn ytJu ylu rlg< mbgbgtoœtbtk vwKo fhJtbtk

lrn ytJu <tu su <u ytRxblt SOR CtJ&e 1.5 dKe vulÕxe Jmwj juJtbtk ytJNu.

3. ºtK fu J^w Jth Wvh bwscle yLg ftuLx[tfxh vtmu&e ftbdehe fhtJJtle Vhs vzNu ylu/y&Jt ºtK fu J^w Jth vulÕxe

fhJtle Vhs vzNu <tu <u mkstudtubtk ftuLx[tfxhlu çjufjeMx fhJtbtk ytJNu sule ykr<b m•tt Bgw.frb¹lh©elu hnuNu.

AHMEDABAD MUNICLPAL CORPORATION

MAHANAGAR SEVA SADAN

Clause : 1 Contractor shall not employ any child having age 5 to 15 years as it is prohibited by Child Labour Prohibition and Regulation

Act 1986. Hon'ble Supreme Court has given certain guide lines and as per the guide lines. If child labour is employed on the site work,

the contractor shall have to deposit Rs. 20,000.00 (Rupees Tw enty thousand only) in the child labour welfare fund. If the employer

refuses to deposit then action will be taken for contempt of Supreme Court Judgement and also will be prosecuted by concerned

authority. Because of the breach of any provision of child labour prohibition and regulation Act 1986 by the Contractor & Municipal

Corporation becomes liable to pay any amount then the Municipal Corporation shall recover the said amount from the contractor.

Clause : 2 The Standing Committee has decided to deduct 1/2% amount from each running bill as per its Reso. No. 1783 Date 06--02-

97, but the Municipal Corporation Board has recently decided that the actual testing charge is taken and the remaining amount is

refundable at the time of final bill (As per Muni. Board Reso. No. 123 dated 25-02-97)

Clause : 3 Contractor has to follow prevailing Labour act and has to maintain labour register acordingly,and has to follow other

Clause : 4 Quantity taken in tender are tentative and may differ as per execution of work. No claim shall be entertain regarding

* MODIFICATION OF DOCUMENTS

Modification of specifications and correction/corrigendum in respect of the work if required will be made by A.M.C. The same shall

be placed on A.M.C website which may be downloaded by the tendrers enclosed along with the tender duly signed. These shall form

a part of tender. The tenderer shall not add or amend the text of any of the documents except in so far as may be necessary to

comply with any addendum.

* ADDENDAUM/CORRIGENDUM .

Addendum or corrigendum conveying any change or correction in respect of the work shall form the part of the contract documents.

The full consideration shall be given to such addendum or corrigendum or correction before submission tender duly filled in by the

contractor. Therefore, the contractor shall have to watch such addendum or corrigendum or correction published by A.M.C through

its website www.egovamc.com. Tenderes shall verify the number of addendum issued and enclose the same with the tender

documents,failing which the tender shall be liable for rejection and no any complaint in respect to this shall be entertained under any

Clause : 5 SCHEDULE OF MAINTENANCE

To keep paver blocks and footpaths durable, safe, and aesthetically pleasing, a structured maintenance schedule is essential. Pavers are

"interlocking" systems, meaning their strength relies on the sand in the joints; if the sand disappears, the blocks move and eventually

Below is a comprehensive maintenance and repair schedule categorized by frequency.

1. Common Defects & Repair Actions

When inspections reveal issues, use this guide to determine the repair method:

A. Sunken or Uneven Blocks (Settlement)

 Cause: Poor base compaction or water washing away the bedding sand.

 Repair: 1. Carefully lift the affected blocks using a flat-head screwdriver or paver extractor.

2. Add additional bedding sand to the base and compact it.

3. Re-install the blocks and sweep new sand into the joints.

B. Missing Joint Sand (The "Linchpin" of Pavers)

 Cause: Rain, wind, or aggressive power washing.

 Repair: Sweep Polymeric Sand into the joints. This sand contains a binder that hardens when misted with water, making it

resistant to washouts and weeds.

C. Cracked or Chipped Blocks

 Cause: Heavy vehicle impact or freeze-thaw cycles.

 Repair: Individual blocks should be replaced. This is why it is recommended to keep "attic stock" (extra blocks) from the

original installation to ensure a color match.

2. Checklist for Footpaths

 Contractor shall execute maintenance works as directed by the client and through self-inspection under the instruction of

Engineer-In-Charge.

 Surveying of footpaths and paver blocks shall be undertaken as and when required on the designated roads and chawls, as

instructed by Engineer-In-Charge.

 The inspection schedule shall be aligned with the following categories of complaints, with priorities determined by the

Engineer-In-Charge:

o CCRS complaints

o Complaints from MLSs/ Councilors

o Complaints from Officials

 The specific roads and chawls shall be surveyed as per below schedule as specified.

o The contractor shall visit the ward office once a week to obtain details of the roads scheduled for inspection

and conduct a survey of footpaths and paver blocks, as directed by the Engineer-in-Charge (EIC)

 The Contractor shall adhere to the maintenance schedule outlined in the tender documents and comply with the prevailing

AMC circulars of SOM issued from time to time.

Contractor's Sign Addl.C.E.(westzone)