P/L Paver block in MP MLA Councilor and other budget and Making and Repairing Foothpath under CCRS Complains, Councilor Complaints At Diff Places in Stadium ward Of WZ (ARC)

Name of Work :- P/L Paver block in MP MLA Councilor and other budget and Making and

Repairing Foothpath under CCRS Complains, Councilor Complaints At Diff Places in Stadium ward Of

Name of Zone:West Zone

Sr Quantity Item Rate Uni Amount

1 600.00 Box cutting the road surface to proper 127.13 Cmt

slope and camber for making a base for

road work including removing the

excavated stuff and depositing on the road

side slope as directed upto 200 Mt.lead

2 600.00 Conveyance charge of earth, lime, 52.42 Cmt

murrum, building rubbish,manual garbage,

sludge, excavated rock ,fly ash, aggregate

of any kind etc. comp.up to 5.0 Km. lead

(Based on Building SOR 2015-16, P-589 -

Item code- 3.2.1)

3 Extra rate over item of excavation of

earth for excavation of asphalt pavement /

RCC of thickness up to 0.20 meter

including demolishing the asphalt carpet,

metal,s oiling/cutting Reinforcement

etc.comp. with stacking the material as

directed. (Based on Previously approved

rate by C E sir )

a 100.00 up to 0.20 meter thickness (By Manual) 70.40 Smt

b 50.00 0.20 to 0.30 meter (By any type of 176.00 Smt

Breaker Machine or R.C.C.Cutter machine

including cost of operator, fuel, &

transportation etc complete.

c 50.00 0.30 meter & above (By any type of 311.08 Smt

Breaker Machine or R.C.C.Cutter machine

including cost of operator, fuel, &

transportation etc complete.

4 200.00 Supplying and fixing of 300 mm-L x 350.89 Rmt

150 mm-B x 380 mm-H Kerb block for

Footpath in M-20 grade using 20 mm

nominal size black trap aggregate of

Sevaliya/Timba or equivalent quality for

pre-cast blocks, reasonably exposed finish/

formwork , mould with well equipped with

vibratory system for kerb stones of

approved design including curing, etc.

complete, including the cost of formwork

etc. complete. The rate shall also include

necessary cutting of asphalt, fixing the

Kerb stones in line and level on 5 cm

thick sand bedding with necessary

equipments and materials. The rate shall

also include the flush pointing in CM (1:3)

for all joints of the kerbstones. Filling of

zari alone the sides of the kerb stone fixed

with Bituminous concrete mixed in proper

position as directed by Engineer in change

to form a portable mixture. In any case

Gravel or such type of materials shall not

be allowed for production. a) Laying on

cm thick Sand Bedding

5 3800.00 Providing and Laying of Rubber 501.60 Smt

Moulded Paver Block Grey/Coloured 60

mm thick, M-35 Grade of any size ; shape

(Usually Uni-Paver Blocks) using black trap

good quality aggragate of 20 mm nominal

size for footpath, parking areas, service

lanes and other areas as mentioned in

the drawing / instruction of engineer in

charge. Cost includes formworks using

rubber mould, Rate providing and laying

paver blocks as per required grading and

specification. The paver block shall be

mechanically compacted. The work of

paving blocks shall be executed in line and

level by skill mason of flooring work only.

It should be laid in such a way that the

no cutting of the paver block to be

necessary. if cutting of paver block

necessary then it should be cut by machine

only and carting. The finished surface of

the paver block shall have resonably good,

plain finished. Paver blocks shall be

compacted and shall be relaid if necessary.

Gravel or such type of materials shall not

be allowed for production. Laying on 5cms

thick sand beddding.

6 100.00 Provdg. & laying cement concrete 1802.24 Cmt

1:5:10 (1 cement : 5 coarse sand :

hand broken stone aggregates 40 mm

nominal size) and curing complete

excluding cost of form work in.

7 Labour work for fixing any kind of

paving with cement pointing in CM 1:2,

including watering, ramming etc comp. as

a 2500.00 Laying on Sand bedding as per 68.64 Smt

requirement to fix the C.C.Block / Nibhada

Stone in Line & Level.

b 50.00 For Water Table & Kerb on Sand 30.80 Rmt

bedding as per requirement to fix the

C.C.Block / Nibhada Stone in Line &

8 200.00 Supplying and fixing Nimbhada ladi 37 233.20 Smt

to 50 mm thick for walk-way covering the

activity of excavation ramming Laying on

sand bedding as per requirement to fix the

Nibhada Stone in Line & Level with

cement pointing in cement mortar 1:2 etc

complete as directed.

9 10.00 P/L brickbats sand concrete (1:2) of 308.00 cmt

one part of sand and two part of old

brickbats including spreading laying

ramming watering and consolidation etc

complete as directed.

10 Providing, laying, spreading and

compacting graded stone aggregate to wet

mix macadam specification including

premixing the Material with water at OMC

in mechanical mix plant carriage of mixed

Material by tipper to site, laying in

uniform layers in subbase / base course on

well prepared surface and compacting with

vibratory roller to achieve the desired

density as per MoRTH clause

400.00 (A) Supply of WMM 1708.13 Cmt

400.00 (B) Laying of WMM 31.25 Cmt

11 Repairing damaged M.H. incl. removing

damaged brick and repairing by masonry in

C.M. 1:5 and plaster in C.M. 1:3 and

fixing C.I. steps and M.H. and carting the

same as directed. (Drainage SOR 2015-16)

50.00 (A) up to 0.15 mt. (@ Two Coarse) 721.60 No.

5.00 (B) up to 0.35mt. (@ Four Coarse) 1144.00 No.

0.00 (C) up to 0.65 mt. (@ Seven Coarse) 1768.80 No

12 100.00 Labour work of fixing Kurb any design 136.40 Rmt

of central verge, (both side) footpath kurb,

items includes necessary excavation, asphalt

cutting of any thickness, erecting in line

and position and pointing with cement

mortar (1:3), watering, etc complete, filling

with zari along the side of the kurb, the

kurb stone fix prepared with bitumnious

top surface, as directed by engineer in

13 3800.00 Removing any kind of pavement incl 12.32 Smt

stacking of serviceble material disposal of

unserviceble material with 50 meter lead

14 80.00 Pre cast concrete kerb Providing and 912.50 rmt

fixing M25 Grade of concrete precast

exposed / Fair finish / texture finish kerb

stones of approved make as per approved

sample of any size and any type. Kerbs

shall be fixed on the foundation prepared

as per approved design. The rate shall also

include for erecting and fixing the pieces

in position for complete kerb system with

chamfered type of kerbs including

necessary accessories of kerb like radius

kerbs, angles and quadrant kerbs, droplet

kerbs etc. complete as per drawing. Kerb

shall be fixed as paper joint without any

jointing material. However cement mortar

shall be provided at the backside of kerb

stone joint. (Sample must be approved)

Cost of excavation, cutting , base , side

filling shall includes as directed engineer -

incharge in above item description as per

BOQ (b) 375 mm high Footpath kerb.

15 85.00 Paver Block Providing and laying shot 669.65 smt

blasted Non - interlocking, Paver

blocks of specified thickness, size,

grade of concrete and colour machine

made and blasting by automatic shot

blasting machine and high density of

as per approved sample of approved make

for footpath, parking areas, service

lanes,cross over and other areas as

mentioned in the drawing. Including

providing and laying 50 mm thick

averave bedding layer of coarse sand below

paver block as per required grading and

specification. Laid paver block shall be

mechanically compacted. The work of the

paving blocks shall be executed in line and

level by skilled mason of flooring work

only. Small size of paver block

with same specification shall be used at

residue or at end. It should be laid in such

a way that the no cutting of the paver

block to be necessary. If cutting of

paver block shall be required , than

cut by machine only and laying to be

done by skilled flooring mason. The

finished surface of the paver block shall

have coarse sand Texture Finish. Pave

blocks shall be compacted and shall be re-

laid if necessary. Actual laid area

shall be measured and paid without any

wastage. (A) 60 mm thick M-35 grade

Grey Paver block of size

200mm x 200mm.(AMC approved rate)

16 25.00 Hiring of Tractor with trolley considering 8 2104.09 Day

Hrs. As working Day hours inclu. Driver (GWSSB

SOR-2022-23 Section-2E- Miscellenous Item No.7)

Total Amount Rs.

Total Amount Rs.

Contractor'sSign Addl.C.E.

MobilNo:- (westzone)

AHMEDABADMUNICIPALCORPORATIONENGINEERDEPARTMENT

TECHNICALSPECIFICATION

Nameof Work :- P/L Paver block in MP MLA Councilor and other budget and

Making and Repairing Foothpath under CCRS Complains, Councilor Complaints At Diff

Places in Stadium ward Of WZ (ARC)

GeneralTechnicalSpecificationSection

FollowingtechnicalspecificationsshallbeapplicabletotherelevantitemsofBOQ

Earth work in cutting in all sorts of soil & murrum incldg.conveyaning ,breaking clods spreading the stuff

as & where dire. With in a lead of 50 mt. from end of cutting.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Conveyance charge of earth, lime, murrum, building rubbish, manure,

garbage, sludge, excavated rock, fly ash, aggregates of any kind Including

spreading & levelling etc. complete.

Themodeofpaymentforthisitemshall beon Cmt. Basis.

Extra rate over item of excavation of earth for excavation of asphaltpavement / RCC of thickness up to

meter includingdemolishing the asphalt carpet, metal, soiling/cutting Reinforcement etc. comp. with stacking the

material as directed. (a) upto 0.20 meter thickness (By Manual)(b) 0.20 to 0.30 meter (By any type ofBreaker

Machine or R.C.C.Cutter machine includingcost of operator, fuel, & transportation etc complete.(c) 0.30 meter &

above (By any type of Breaker Machine or R.C.C.Cuttermachineincludingcostofoperator,fuel,&transportationetc

TheItemshallbecarriedoutasperItemdescriptionandasperinstructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.

Therateincludesthecostofexcavationofbituminousmacadami.e.bituminouslayersonlylikeDBM,BCetcincludingthelabours,tools,e

quipmentandallotherincidentalexpenses.NonBituminousSub-layer/Subbasearenotconsideredinthisitem.

WorkshallbecarriedoutmanuallyorbyMachineryaspersiterequirements.The

modeofpaymentforthisitemshall beon Smt. Basis.

Supplying and fixing of 300 mm-L x 150 mm-B x 380 mm-H Kerb block for Footpath in M-20 grade using 20 mm

nominal size black trap aggregate of Sevaliya/Timba or equivalent quality for pre-cast blocks, reasonably exposed

finish/ formwork , mould with well equipped with vibratory system for kerb stones of approved design including curing,

etc. complete, including the cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt,

fixing the Kerb stones in line and level on 5 cm thick sand bedding with necessary equipments and materials. The

rate shall also include the flush pointing in CM (1:3) for all joints of the kerbstones. Filling of zari alone the sides of

the kerb stone fixed with Bituminous concrete mixed in proper position as directed by Engineer in change to form a

portable mixture. In any case Gravel or such type of materials shall not be allowed for production. a) Laying on 5 cm

thick Sand Bedding .

Thespecifictionoffollowingmaterialsshallbeconformingwithspecificationmentionedforrelaventmaterial/itemsinGeneraltechnic

alspecification for buildingworkofR&B DepartmentofGujarat.

Water shall conform

to M-1 Cement to M-20

Graded stone aggregate 20 mm.nominal size to M-10

Contractor shall have to manufacture the blocks as per the dimensions given in the drawing. Specific machineries

tomanufacturetheprecastblocks.Thesemachineriesshouldbecompatibletoproduceblocksofrequiredstrengthanddimensions. The

machine shall contain hydraulic Press or advanced equipment to generate required compaction & Grade andfinish.

Moulds/ Steel Plates/ Dies of the machine shall be dimensionally checked & to be got approved before commencing

theproduction. Contractor shall prepare proper Drying Yard for keeping the blocks before curing. The drying yard shall

levelledandcoveredsothatnoshrinkagecracksareformed.Contractorshallprepareadequatesizecuringpondtocuretheblocksfornotles

sthan21Days.Noothermeansofcuringshallbeallowed.ThetechnicalspecificationofconcreteshallconfirmtoIS456-2000. The concrete

mix is not required to be designed and only nominal mix as per IS: 456-2000 shall be followed. The proportionof the

concrete mix shall be 1:1.5:3 (1 cement: 1.5 coarse sand: 3 graded stone aggregate 20 mm. nominal size) by

volume.Concrete work shall have fairly exposed concrete surface or as specified in the item. The designation ordinary

M-10, M-15, M-20,M-25 specified as per I.S. corresponds approximately to 1:3:6, 1:2:4, 1:1.5:3 and 1:1:2 nominal mix of

ordinary concrete, byvolume respectively. The ingredients required for ordinary concrete containing one bag of cement

of 50 Kg. by weight (0.0342m3.) for different proportions of mix shall be as per IS 456-2000. The proportion of the

aggregate for the kerb stone shall bemodified as per the approval of the engineer-in-charge. The water cement ratios

shall not be more than those specified as per IS.The cement of the mix shall be increased, if the quantity of water in

a mix has to be increased to overcome the difficulties ofplacement and compaction so that the water cement ratio

specified in the table is not exceeded. The maximum size of coarseaggregate shall be as large as possible within the

limits specified but in no case greater than 1/4th of the minimum thickness

ofthemember,providedthattheconcretecanbeplacedwithoutdifficultysoastosurroundallreinforcementthoroughlyandtofill the

corners of the form. For reinforced concrete work, coarse aggregates having a nominal size of 20 mm. are

generallyconsidered satisfactory. Admixture shall be used in concrete only with approval of the Engineer-in-charge based

upon theevidence that with the passage of time, neither the compressive strength of concrete is reduced nor are other

requisite qualitiesofconcrete impaired bythe useofsuch admixtures.

Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50 kg weight. The

volume ofone such bag can be taken as 0.0342 m3. Boxes of suitable sizes shall be used for measuring sand and

aggregate. The size of theboxes (internal)shall be 30cm.x30 cm.and38 cm.deep. While measuring the aggregate

andsand,the boxshall be filledwithout shaking ramming or hammering. The proportioning of sand shall be on the basis

of its dry volume and in case of dampsand;allowancesforbulkageshallbe made.

For all work, concrete shall be mixed in a mechanical mixer which along with other accessories shall be kept in

first class workingcondition and maintained throughout the construction. Measured quantity ofaggregate, sand, and

cement required for eachbatch shall be poured into the drum of the mechanical mixer while it is continuously running.

After about half a minute of dry-mixing, measured quantity of water required for each batch of concrete mix shall be

added gradually and mixing continued foranother one and a half minute. Mixing shall be continued till materials are

uniformly distributed and uniform colour of the

entiremassisobtainedandeachindividualparticleofthecoarseaggregateshowscompletecoatingofmortarcontainingitsproportionate

amount of cement. In no case shall the mixingbe done for less than 2 minutes after all ingredients have been putinto

the mixer. Mixers which have been out of use for more than 30 minutes shall be thoroughly cleaned before putting in

a newbatch. Unless otherwise agreed to by the Engineer-in-charge, the first batch of concrete from the mixture shall

contain only2/3rds of normal quantityof coarse aggregate. Mixing plant shall be thoroughlycleanedbefore changingfrom

one type ofcement toanother.

The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete

shall bedetermined by regular slump tests in accordance with IS: 1199-1959. The slump of 10 mm. to 25 mm. shall be

adopted whenvibratorsare used.

All Moulds shall be cleaned and made free from standing water, dust, snow, or ice immediately before

placing of concrete.Formwork/MetalMould forexposed concrete surface(Ifindicated):

Allthemouldsshallbecheckedforexactdimensionsoftheprecastblocks.Alltheedgesoftheprecastblocksshallconfirmthe

profile of the final drawing & edges/ curvatures of the moulds shall be checked accordingly. Moulds shall be

regularly checked forcorrectnessofdimensionsofBlocks, twists, bendsdueto handling, etc.Beforestartingevery dayswork.

Care shall be taken to set all form work/Mould in perfect line, level (or in required camber or slope as specified)

and plumb. Formwork/Mould propping shall be strong, rigid, and sturdy. The form work/Mouldshall be as per pattern &

design shown indrawings. Form work/Mould shall be done accurately and precisely so as to achieve neat, clean and

smooth concrete surface, inline, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall not

be allowed. Before placing concrete,forms shall be thoroughly cleaned off of all rust, dust, and loose materials.

Colourless oil or grease of approved quality shall

beappliedbeforeplacingsteel.Alsotheformworkmaterialwillbeofwood/plywood/steeloranysortofsuchmaterial,as approved by

the Engineer-in-Charge and/or his authorized representative; so that all exposed concrete surfaces have uniformcolour.

Forallkindofexposedconcreteworkonlyonebrand(tobeapprovedbytheEngineer-incharge)ofcementshallbeused.

RemovalofMoulds:

Specific time shall be identified for removal of moulds, such that the concrete of the precast blocks shall gain

strength towithstand the stresses generated due to self weight and handling to drying yards without any deformation

to shape/ dimensions/edges.

Sufficient time shall be given to the block after it is removed from the mould so that it can gain strength and dry

in shade toprevent anycracksdue to shrinkage. Thisshall be doneindryingyards.

Curingofblockshallbedoneonlyincuringpondandcuringshallbedoneforminimum14days.

Drying period after removing from pond & before delivery to site:Water should be drained of from the block

before it is actuallysent to the site. Time should be provided for proper draining of water which may be present in the

block kept for curing in thepond.

Precautionshallbetakenwhiletransportingoftheblocksto site.

Theblocksshouldbeloadedandunloadedwithduecaresoastoavoidgenerationofstressesleadingtobreakingofblock.Careshould be

taken toprevent the block from breakingduring transporting.

The pits of the size 150mm in width and required depth shall first be excavated, true to line and level. The

relevant specificationsof item A- 1 shall be followed for excavation work. The pits shall be filled with a layer of 50mm.

thick sand bedding. The curbsthen shall be placed in position of which 50mm. shall be below road. Care should be

taken to maintain proper line and level.Thejointsbetween thekerbsshallbepointed withC.M.1:2and

curedforminimumsevendays.

Samplingandtestingofconcrete:

Samples from fresh concrete shall be taken as per IS : 1199-1959 and cubes shall be made, curedand tested at

days or 28 daysas per requirements in accordance with IS : 516-1959. A random sampling procedure shall be adopted

to ensure that eachconcrete batch shall have a reasonable chance of being tested i.e. the sampling should be spread

over the entire period ofconcretingandcoverallmixing units.

At least 1 sample shall be taken from each shift. Ten test specimens shall be made from each sample, 5 for

testing at 7 days, andthe remaining 5 at 28 days. The samples of concrete shall be taken on each day of the

concreting as per above frequency. Thenumber of specimens may be suitably increased as deemed necessary by the

Engineer-in-charge when procedure of tests givenabove reveals a poor quality of concrete and in other special cases.

The average strength of the group of cubes cast for each dayshall not be less than the specified cube strength of

Kg/cm2 at 28 days. 20% of the cubes cast for each day may have valueless than the specified strength provided the

lowest value is not less than 85% of the specified strength. If the concrete made inaccordance with the proportions

given for a particular grade, does not yield the specified strength, such concrete shall beclassified as belonging to the

appropriate lower grade. Concrete made in accordance with the proportions given for a particulargrade shall

not,however,be placedinahighergrade onthe ground thatthe teststrengthare higherthanthe minimumspecified. If rock

pockets/honeycombs in the opinion of Engineer-in-charge are of such an extent or character so as to affect thestrength

of the structure,materially or toendanger the life of the steel reinforcement, he may declare the concrete defectiveand

requirethe removalandreplacement oftheportionofthe structureaffected.

PrecastKerbStones:

The relevant specifications of concreting as per item above shall be followed except that work shall be carried out for

precastconcrete kerb stones as specified in the item. All Precast members shall be cast at workshop. Sufficient curing

shall be donebefore placement of the samethe method of transporting and placing the precast members shall be as

approved by theEngineer-in-charge. Members shall be so transported that no breakage or undue stresses are induced in

them. If required, allmembers shall have a key provided on both the faces i.e top and bottom surfaces, of adequate

size so as to fill the same withconcrete while laying. The function of this key is to avoid the leakage through the joint

between the precast member and thememberonwhichit islaid.

ModeofMeasurementsandPayment:

Therate shallinclude costof formworkandcost ofreinforcement. Thevolumeoccupiedbyreinforcement shallnot

bedeductedfromR.C.C.work.

The rate shall be for a unit of Rmt.

Providing and Laying of Rubber Moulded Paver Block Grey/Coloured 60 mm thick, M-35 Grade of any size ;

shape (Usually Uni-Paver Blocks) using black trap good quality aggragate of 20 mm nominal size for footpath, parking

areas, service lanes andother areas as mentioned in the drawing / instruction of Engineer-in-Charge and/or his

authorized representative. Costincludes formworks using rubber mould, Rate providing and laying paver blocks as per

required grading and specification. Thepaver block shall be mechanically compacted. The work of paving blocks shall

be executed in line and level by skill mason offlooring work only. It should be laid in such a way that the no

cutting of the paver block to be necessary. if cutting of paverblock necessary then it should be cut by machine only

and carting. The finished surface of the paver block shall have resonablygood, plain finished. Paver blocks shall be

compacted and shall be relaid if necessary. Gravel or such type of materials shall notbe allowedfor

production.Layingon50mmthick sandbedding.

• Layingon50mmthicksandbedding.

Excavation and compaction up to 300 mm in height for footpath paving in all sorts of soil murrum includingsorting

outsandstackingofusefulmaterialsstuffupto 50mt.

The scope of work includes manufacturing, supplying, and lying of precast paver blocks at various Retail outlets.

The workincludes: Verification of the existing site condition and advising our project in charge to lay suitable base

course if required.Contractors are required to satisfy themselves with quality of sub grade, sub-base course before the

paver blocks are laid andsuggest strengthening ifrequired.

Clearing the site by removing all obstacles such as stones, debris etc. for laying of paver blocks. Manufacturing of

paver blocks inyour plant as per requirements in technical specification enclosed. Supplying of paver blocks at site,

including handling at bothends.

Laying of paver blocks at site as per requirement in technical specification on 50 mm thick sand bedding, within

shortest possibletime the site is public place hence care should be taken to ensure that the routine activities should

not be disturbed. The job oflayingmayrequired tobe carried outduringnightalso.

TestingofpaverblocksshallthroughreputedGovt./NonGovt.Testhouseonlyandsubmissionoftestresultsasperrequirements in

Technical Specifications. AMC reserves the right to carryout test at random. Cost for such tests to be borne byparty.

The contractor shall guarantee that all material and components designed, fabricated, supplied, and laid by him shall

befree from any type of defect due to faulty material and/or workmanship/erection for a period of One year from the

date ofcompletion ofwork.However,thecontractorone year'sshallrender freemaintenance.

TECHNICALSPECIFICATIONS:

PaverBlockManufacturingFacilities:

ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:

ConcreteBlockmakingMachines:

The machine shouldbe capable of producinghighqualityPaverBlocks byobtaininghighlevelof compactionbyapplication

of hydraulic compaction and also by high intensity vibration to the moulds. The machine should

haveautomaticcontrol panel

foruniformityinstrength.

ConcreteBatching&MixingPlant:(Notessential)

The concrete Mix Design should be followed for each batch of materials. The concrete ingredient should be

mixed inconcrete Batching & Mixing plant with minimum capacity of 30 cum/hour. The plant should equipped

with automaticcontrol panel formaintaining watercement ratiofrombatch to batch to obtain concrete of uniform

andstrength.Theplantshouldbeequippedwithadequatemechanismformechanizedloadingofrawmaterialsintomixer

andconveyorbeltfortransportationofconcretefrommixertoconcreteblockmakingmachinetomaintainqualityofwet

Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.

Laboratory(Desirablebutnotessential):

The testing equipment should have required in the Laboratory as perthe

following:ACompression testingmachineofadequate capacity.

Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.

Systematic record of test results of various paver blocks manufactured in

the factory.ConcreteMixDesignfor

variousgradeofconcreteusedformakingofpaverblocks.

SpecificationsForColouredPaverBlocks:

Coloured concrete paver blocks shall be manufactured as per attached specifications using or equivalent

approvedcolourPigmentof“BAYER”Make“BAYFERROXIRONOXIDEPIGMENTS”withminimumcolourpigmentof3%byweight

of cement. The colour shade shall be “RED” as selected by AMC before commencement of the work. White

cement shallbe used for colored pavers to obtain the desired colour shade. The job also includes providing

mm thick sand beddingto matchthe shadeofthe paverblock.

Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingofthe

Allothertechnicalspecifications&Procedurefortesting,laying&samplingofcolouredpaverswillbeasperattachment.

PaversBlockCharacteristics:

The concrete pavers should have perpendicularities after release from the mould and the same should be

retained untilthe laying. The surface should be reasonably smooth and of anti skid and anti glare type. The

paver should have uniformchamfers to facilitate easy drainage surface run off. The pavers should have uniform

interlocking space of 2mm to 3mmto ensure compacted sand filling after vibration on the paver Surface. The

concrete mix design should be followed foreach batch of materials separately and automatic batching plant is

to be used to achieve uniformity in strength andquality.The pavers shall be manufactured in single layer only.

Skilled labour should be employed for laying blocks toensure line and level of laying, desired shape of the

surface and adequate compaction of the sand in the joints. Thepavers shall be of cement gray colour without

any pigment & for coloured pavers refer “specifications for colouredpave`” The pavers are to be skirted all

round with kerbing using solid concrete blocks of size 150mm X 250mm X 380mm.The kerbing should be

embedded for 100mm depth. The concrete used for kerbing shall be cured properly for 7 daysminimum.

PaverBlockDimensions:

Shape Unipaver,IshapeordirectedbyAddl.C.E.

Chamfer 4mmto6mmalongtopedges

Colour Naturalcementgreycolourwithoutuseofanypigment.

Forcolouredpaversrefer“specificationsforcolouredpavers”

DimensionalTolerance (+/-)2mmforlength&width,

(+/-)3mmforHeight(Thickness)

TestingofPaverBlocks:

SR *TEST AverageValues Frequency

1. CompressiveStrength Min.35N/Sqmmfor60m 250Smt/1T

2. FlexuralStrength Minimum4.5N/Sqmm

3. AbrasionResistance Maximum1.5

4. WaterAbsorption Maximum5.80%

*Samplingandtestingprocedureasperenclosedspecifications

SamplingandTestingProcedureforPaverBlocks

INTERNAL–Averageofminimum3samplesper 5000Blocks.

SamplingforTesting

SamplingofPaverblocks.

Methodofsampling :

Before laying paver blocks, each designated section comprising not more than 50000 blocks, shall be divided into

tenapproximately equalgroups. Threeblocksshallbe drawnfrom each group.

Markingandidentification:

All samples shall be clearly marked at the time of sampling in such a way that the designated section of part

thereof, andtheconsignmentrepresentedbythesample,areclearlydefined.

The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving

intransit. Protect the paving from damage and contamination until they have been tested. The testing shall be carried

assoon as possible, after the sample has been taken. As soon as practicable after sampling. The samples shall be stored

inwaterat20degreeC5 degreeC for24 hourspriortotesting.

The item is to be executed as per instructions and to the entire satisfaction of Engineer-in-Charge and/or his

authorizedrepresentativeusingRubbermould andTablevibratorforKerb instead ofmechanicalpresssystem.

Extra rate for excavation of asphalt payment of any thickness including demolishing the asphalt carpet, metal, soling

etc.complete with stacking the materials as directed. The road surface of asphalt shall carefully be opened to full width

asdirected by the Engineer-in-Chargeand/or hisauthorizedrepresentative.

Excavationareashallbeproperlyidentifiedandmarkedinrectangularshape.Theroadcrustshallbeopeneduptoentire depth i.e.

including soling. All the materials shall be separately deposited in such a way and in places as may bedetermined by the

Engineer-in-Charge and/or his authorized representative. In case rubble not being so deposited orbeing mixed up with

the excavated materials will not be allowed for refilling. The cost of materials shall be charged fromthecontractor.The

decision oftheC.E.shall befinal and bindingtothecontract

For detailed specification for Laying of Paver Block on sand bedding, refer R & B Department booklet for

GeneralTechnicalSpecificationforbuilding works.

Therate shallbefor aunitofSMT

Providing and laying cement concrete 1:5:10 (1- Cement : 5- fine sand : 10- graded brick bat aggregates 40mm

nominal size)and curingcomplete.

Before starting the concrete the bed of the foundations trenches shall be cleared of all loose materials and

watered and rammedas directed. The proportion of cement, sand and hand broken stone aggregates shall be one

part of cement, 5 parts of coarsesand, 10parts of hand broken stone aggregates and shall so measured by volume.

The concrete shall be mixed in a mechanicalmixer at the site of work. Hand mixing may however be allowed for

smaller quantity of work if approved by the Engineer-incharge.WhenhandmixingispermittedbytheEngineer-

inchargeincaseofbreakdownofmachinery’sandintheinterestofthe work. itshall be carriedout on a water tight platform

and care shall be taken to ensure that mixing is continued until themass is uniform in colour and consistency. The

quantity of water shall be sufficient to produce a dense concrete of requiredworkability for the purpose. The

concrete shall be handled from the place of mixing to the final position in not more than 15minutes by the method

as directed and shall be placed into its final position, compacted and finished within 30 minutes of mixingwith water

i.e. before the setting commences. The concrete shall be laid in layers of 15 cms. to 20 cms. The concrete shall

berammed with heavy iron rammers and rapidly to get the required compaction and to allow all the gaps to be

filled with mortar.After the final set, the concrete shall be kept continuously wet, if required by pounding for a

period of not less than 7 days fromthe date of placement The concrete shall be measured for its length breadth and

depth, limiting dimensions to those specified onplan or asdirected.

ModeofmeasurementsshallbeonCMTbasis

Labour work for fixing interlocking blocks / any kind of pavement on up to 50 mm th sand bedding, levelling,

watering and fixing in line & level as well cleaning the site etc.comp. as directed.

Therateshallbe foraunit of SMT BASIS.

Supplying and fixing Nimbhada ladi 37 to 50 mm thick for walk-way covering the activity of excavation ramming

Laying on sand bedding as per requirement to fix the Nibhada Stone in Line & Level with cement pointing in cement

mortar 1:2 etc complete as directed.

Modeofmeasurementsshall beon smt.basis.

P/L brickbats sand concrete (1:2) of one part of sand and two part of old brickbats including spreading laying

ramming watering and consolidation etc complete as directed.

Modeofmeasurementsshall beon cmt.basis.

Providing, laying, spreading and compacting graded stone aggregate to wet mix macadam specification including

premixing the Material with water at OMC in mechanical mix plant carriage of mixed Material by tipper to site, laying

in uniform layers in sub- base / base course on well prepared surface and compacting with vibratory roller to achieve

the desired density as per Codal Provision.

Production & Supply of WMM to site

of worksLayingof WMM

This work shall consist of laying and compacting clean, crushed, graded aggregate and granular material, premixed

with water, toa dense mass on a prepared sub-grade/sub- base/ base or existing pavement as the case may be in

accordance with therequirements of these Specifications. The material shall be laid in one or more layers as necessary

to lines, grades and cross-sectionsshownon the approved drawingsorasdirected bytheEngineer.

The thickness of a single compacted Wet Mix Macadam layer shall not be less than 75 mm. When vibrating or

other approvedtypes of compacting equipment are used, the compacteddepth of a single layer of the sub-base

coursemay be upto 200 mmwith the approval ofthe Engineer.

PhysicalRequirements

Coarseaggregatesshallbecrushedstone.TheaggregatesshallconformtothephysicalrequirementssetforthinTable19-1.

Sevaliya/Timba/Ankodiyaspecialaggregateisonlyacceptable.

Ifthewaterabsorptionvalueofthecoarseaggregateisgreaterthan2percent,thesoundnesstestshallbecarriedoutonthematerialdeliv

eredto site asperIS:2386 (Part-5).

Table19-1:PhysicalRequirementsofCoarseAggregatesforWetMixMacadamforSub-base/BaseCourses

S.No. Test TestMethod Requirements

1. LosAngelesAbrasionvalu IS:2386(Part-4) 40percent(Max.)

eorAggregateImpact value

IS:2386(Part- 30percent(Max.)

2. CombinedFlakinessandElongationindices( IS:2386(Part-1) 35percent(Max.)*

* To determine this combined proportion, the flaky stone from a representative sample should first beseparated out. Flakiness index is weight of

flakystone metal divided by weight of stone sample. Only the elongated particles be separated out from the remaining (non-flaky) stone metal.

Elongation index isweightofelongatedparticlesdividedbytotalnon-flakyparticles.Thevaluesofflakinessindexandelongationindexsofoundareaddedup

GradingRequirements

TheaggregatesshallconformtothegradinggiveninTable19-2.

Table19-2:GradingRequirementsofAggregatesforWetMixMacadam

ISSieveDesignation PercentbyweightpassingtheISSieve

Materialfinerthan425 micronshallhavePlasticityIndex(PI)notexceeding6.

The final gradation approved within these limits shall be graded from coarse to fine and shall not vary from the

low limit on onesievetothehighlimit ontheadjacentsieve orviceversa.

Operations:-Preparation

The surface of the sub-grade/sub-base/base toreceive the Wetmixmacadam courseshall be preparedtothe

specifiedgradeand camber and cleaned of dust, dirt and other extraneous material. Any ruts or soft yielding places shall

be corrected in anapproved manner and rolleduntil firmsurface isobtained.

Where the Wet mix macadam is to be laid on an existing metalled road, damaged area including depressions and

potholes shallbe repaired and made good with the suitable material. The existing surface shall be scarified and re-

shaped to the required gradeand camberbeforespreadingthe coarseaggregate forWetmixmacadam.

PreparationofMix

WetMixMacadamshouldbepreparedinanapprovedmixingplantofsuitablecapacityhavingprovisionforcontrolledadditionof

water and forced/positive mixing arrangement like pugmill or pan type mixer of concrete batching plant.For small

quantity ofwet mixwork,theEngineermay permitthemixingtobedone in concrete mixers.

Quantityof watershouldnotvaryfrom OMC determinedas perIS : 2720 (partVIII)bymore thanagreedlimit.The

mixedmaterialshould be uniformly wetand nosegregation should be permitted.

Immediately after mixing, the aggregates shall be spread uniformly and evenly upon the prepared subgrade/sub-

base/base inrequired quantities. In no case should these be dumped in heaps directly on the area where these are to

be laid nor shall theirhaulingover a partlycompleted stretchbe permitted.

The mix may be spread either by a paver finisher or motor grader or as per instruction of Engineer-in-Charge and/or

hisauthorized representative. For portions where mechanical means cannot be used, manual means as approved by the

Engineershall be used.The motor grader shall be capable of spreading the material uniformly all over the surface. Its

blade shall havehydrauliccontrolsuitableforinitialadjustmentsandmaintainingthesame soasto achievethespecifiedslopeand

Thepaver finishershallbeself-propelled,havingthefollowingfeatures:

(i) Loadinghoppersandsuitabledistributionmechanism

screedshallhavetampingandvibratingarrangementforinitialcompactiontothelayerasitisspreadwithoutruttingorotherwisemarringth

e surface profile.

(iii) Thepavershallbeequippedwithnecessarycontrol mechanismsoas toensurethatthefinishedsurfaceisfreefrom

surfaceblemishes.

The surface of the aggregate shall be carefullycheckedwithtemplates andall high or low sports remediedbyremoving

oradding aggregate as may be required. The layer may be tested by depth blocks during construction. No segregation

of layer andfineparticlesshouldbeallowed.Theaggregatesasspreadshouldbeofuniformgradationwithnopocketsoffinematerials.

Afterthemixhasbeenlaidtotherequiredthickness,gradeandcrossfall/camberthesameshallbeuniformlycompacted,tothefulldepth

withsuitableroller.Ifthethicknessofsinglecompactedlayerdoesnotexceed100mm,smoothwheelrollerof80to

100 kN weight may be used. For a compacted single layer upto 200 mm, the compaction shall be done with the help

of vibratoryrollerofminimum staticweightof80to100kNorequivalentcapacityroller.Thespeedoftherollershallnotexceed5km/h.

In portions having unidirectional cross fall/superelevation, rolling shall commence from the lower edge and progress

graduallytowards the upper edge. Thereafter, roller should progress parallel to the centre line of the road, uniformly

over-lapping eachpreceding trackbyatleastone thirdwidthuntil theentire surfacehas beenrolled.Alternate trips of the

rollershallbeterminated instopsatleast 1m away from any preceding stop.

In portions in camber, rolling should begin at the edge with the roller running forward and backward until the edges

have beenfirmly compacted. The roller shall then progress gradually towards the centre parallel to the centre line of

the road uniformlyoverlappingeach oftheprecedingtrack by at least one-third width untiltheentiresurfacehasbeen rolled.

Any displacement occurring as a result of reversing of the direction of a roller or from any other cause shall be

corrected at onceasspecifiedand/or removedandmade good.

Along forms, kerbs, walls or other places not accessible to the roller, the mixture shall be thoroughly compacted with

mechanicaltampers or a plate compactor. Skin patching of an area without scarifying the surface to permit proper

bonding of the addedmaterialshall notbepermitted.

Rolling should not be done when the subgrade is soft or yielding or when it causes a wave-like motion in the sub-

base/basecourse or subgrade. If irregularities develop during rolling which exceed 12 mm when tested with a 3 metre

straight edge, thesurface should be loosened and premixed material added or removed as required before rolling again

so as to achieve a

uniformsurfaceconformingtothedesiredgradeandcrossfall.Innocaseshouldtheuseofunmixedmaterialbepermittedtomakeupthe

depressions.Rolling shall be continued till the density achieved is at least 98 per cent of the maximum dry density for

thematerialasdetermined by the method outlinedin IS :2720(Part-8).

Aftercompletion,thesurfaceofanyfinishedlayershallbewell-closed,freefrommovementundercompactionequipmentorany

compaction planes, ridges, cracks and loose material. All loose, segregated or otherwise defective areas shall be made

goodto the fullthicknessofthelayer andrecompacted.

Settinganddrying:

Afterfinalcompactionofwet mixmacadamcourse,theroadshallbeallowedtodryfor24hours.

OpeningtoTraffic

Preferably no vehicular traffic of any kind should be allowed on the finished wet mix macadam surface till it has dried

and thewearingcourse laid.

Surface Finish and Quality Control

of WorkSurface evenness:

ThesurfacefinishofconstructionshallconformtotherequirementsofClauseinItemNo.16&17&18.

Qualitycontrol:

ControlonthequalityofmaterialsandworksshallbeexercisedbytheEngineerasperTable19-3.

Table19-3:TestandFrequencyforMaterialsforWetMixMacadam

Type Test Frequency ISCode

ofConstructi (Asper CircularNo.66)

Wet Gradation Onetestper200Cu.m. IS:2386,Part-I-

m AggregateImpactValue Onetestper1000Cu.m. IS:2386,Part-IV

Combined Onetestper500Cu.m. IS:2386,Part-I

andElongationIndices

Atterberg Limits of Onetestper200Cu.m. IS:2720,Part-V

portion ofaggregatespassing

Densityofcompactedlayer Onesetofthreetestsper IS:2720,Part-VIII

RectificationofSurfaceIrregularity

Where the surface irregularity of the wet mix macadam course exceeds the permissible tolerances or where the

course isotherwise defective due to subgrade soil getting mixed with the aggregates, the full thickness of the layer shall

be scarified overthe affected area, reshaped with added premixed material or removed and replaced with fresh

premixed material as applicableand recompacted. The area treated in the aforesaid manner shall not be less than 5 m

long and 2 m wide. In no case shalldepressionsbefilledup withunmixed andungraded materialor fines.

ArrangementforTraffic

Duringtheperiodofconstruction,arrangementsforthetrafficshallbeprovided.TheContractorshalltakeallnecessarymeasures for

the safety of traffic during construction and provide, erect and maintain such barricades, including signs, marking,flags,

lightsand flagmenasper instruction oftheEngineer-in-charge.

MeasurementsforPayment

Therateshallbe foraunit ofonecubic meter.

Repairing damaged M.H. and rasing M.H. up to road level incl. removing damaged brick work and repairing by brick

masonry in C.M. 1:5 and plaster in C.M. 1:3 and fixing C.I. steps and existing MH sheet cover, removing the debris

from MH and carting the

MeasurementsforPayment

The rate shall be for a unit of one cubic meter.

Labour work of fixing kurb any design of central verge, (both side) footpath kurb, items includes necessary

excavation, asphaltcutting of any thickness, erecting in line and position and pointing with cement mortar (1:3),

watering, etc complete,

fillingwithzarialongthesideofthekurb,thekurbstonefixpreparedwithbitumnioustopsurface,asdirectedbyengineerincharge.

Work shall be carried out as per item description including cost of all labour and materials etc. complete

as directed.General standardpracticeof layingof paverblockis applicable.

ThemeasurementsshallbeonRMT basis.

Removing any kind of pavement incl stacking of serviceble material disposal of unserviceble material with 50 meter

Therate shallbefor aunitofSMT

Pre cast concrete kerb Providing and fixing M25 Grade of concrete precast exposed / Fair finish / texture finish

kerb stones of approved make as per approved sample of any size and any type. Kerbs shall be fixed on the

foundation prepared as per approved design. The rate shall also include for erecting and fixing the pieces in position

for complete kerb system with chamfered type of kerbs including necessary accessories of kerb like radius kerbs,

angles and quadrant kerbs, droplet kerbs etc. complete as per drawing. Kerb shall be fixed as paper joint without any

jointing material. However cement mortar shall be provided at the backside of kerb stone joint. (Sample must be

approved) Cost of excavation, cutting , base , side filling shall includes as directed engineer - incharge in above item

description as per BOQ (b) 375 mm high Footpath

(1) Water shall conform to M-1.

(2) Cement shall conform to M-3.

(3) Sand shall conform to M-6.

(4) Stone aggregate shall conform to M-12

(5) Pre cast kerb shall be of approved make and as per approved sample.

1.0 Workmanship :

1.1 2.1 All Precast exposed/ fare finish/ texture finish kerb stones shall be of approved make.Sufficient curing

shall be done before placement of the same.

2.2 The method of transporting and placing the precast members shall be as approved by theArchitect and

Engineer-in charge. Members shall be so transported that no breakage orundue stresses are induced in them.

2.3 The pits of the size 0.15 M in width and 0.23 M. in depth or as per site condition shall first be excavated,

true to line and level. The specifications for excavation shall be followed as per relevant item.

2.4 The pits shall be filled with a layer of 0.15 M. thick lean concrete M15. The kerbs shall be laid on existing

PCC base in true line and plumb. The specifications for PCC work shall be followed as per relevant item.

2.5 The rate shall also include for erecting and fixing the pieces in position for complete Kerb systems with

Chamfered type of kerbs including all type of necessary accessories of kerb like Radius Kerbs, Angles and Quadrant

Kerbs, inlet kerb etc complete as per drawing. The rate shall also include the flush pointing in CM (1:2) for all joints

of the kerb stones.

3.0 Mode of Measurement & Payment:

3.1 The rate shall include the cost of material and labour for fixing the kerb system including laying, jointing and

finishing but excluding the cost of excavation, bitumen cutting, base PCC, zari filling with bitumen material

3.2 The Measurement of the item shall be in Rmt basis.

Paver Block Providing and laying shot blasted Non - interlocking, Paver blocks of specified thickness, size, grade of

concrete and colour machine made and blasting by automatic shot blasting machine and high density of as per

approved sample of approved make for footpath, parking areas, service lanes,cross over and other areas as mentioned

in the drawing. Including providing and laying 50 mm thick averave bedding layer of coarse sand below paver block as

per required grading and specification. Laid paver block shall be mechanically compacted. The work of the paving

blocks shall be executed in line and level by skilled mason of flooring work only. Small size of paver block with same

specification shall be used at residue or at end. It should be laid in such a way that the no cutting of the paver block

to be necessary. If cutting of paver block shall be required , than cut by machine only and laying to be done by

skilled flooring mason. The finished surface of the paver block shall have coarse sand Texture Finish. Pave blocks shall

be compacted and shall be re-laid if necessary. Actual laid area shall be measured and paid without any wastage. (A)

60 mm thick M-35 grade Grey Paver block of size 200mm x 200mm.

The Item shall be carried as per Item Description in tender document and as Per prevailing latest IS & IRC Code

& Genral Specification booklet and As per instruction of Engineer-in-Charge and/or his authorized representative. The

mode of payment for this item shall be on Smt. Basis

Hiring of Tractor with trolley considering 8 Hrs. As working Day hours inclu. Driver (GWSSB SOR-2022-23

Section-2E- Miscellenous Item No.7)

I HAVE ALSO GONE THROUGH TECHNICAL SPECIFICATIONS FOR THE ITEMS (AS PER STANDARD P.W.D.

TECHNICAL SPECIFICATION FOR THE ITEMS AND ALSO I HAVE THE BOOK OF THE SAME) AND AGREE TO ABIDE

IN CASE OF WHERE IS NO TECHNICAL SPECIFICATION FOR THE ANY ITEMS AVAILABLE, SPECIFICATION

GIVEN BY THE ENGINEER-IN-CHARGE SHALL BE FOLLOWED AND FOR THE SAME I AGREE TO ABIDE BY THEM.

Seal and Signature of the Bidder Add.City Engineer (WestZone)

Amdavad Municipal Corporation

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

bntldh muJtmœl – œrûtK vrùbÍtul

vrùb Ítul Ítulj ytuVem,

1. Wvhtuf< xuLzhtu su <u Jdobtk btLg hSMx[uNl ^htJ<t ftuLx[tfxh©eytuyu ChJt.

2. xuLzhle rlg< xuLzh Ve <&t R.yub.ze. ck^ fJhbtkk Wvh lt mhltbu ÁcÁ / hSMxh yu.ze./ MvezvtuMx/ fwhegh&e rlg< mbgbtk

btufjJtlt hnuNu.

3. ftuLx[tfxh©eytuyu xuLzhle mt&u BGþrlrmvj btLg hSMx[uNlle/ dJobuLx hSMx[uNlle ftuve, (xuLzh ftuve <&t yLg vwhtJt mt&u) yawf

mtbuj fhJtle hnuNu ylu fJh Wvh xuLzh lkch <&t ftuLxufx lkch sYh MvÐ œNtoJJtltu hnuNu.ck^ fhJh Wvh xuLzh ltuxem lkch,

xuLzh lkch, ftblwk ltb <&t, ftuLx[[tfxhle mkM&tlwk ltb <&t ftuLxufx lkch yJ~g œNtoJJtlt hnuNu. ftuLx[tfxhtuyu xuuLzhbt cukfl wltb,

Ft<t lkch, btRfh lkch ylu mhltb wMvÐ yûthtubtk jFJw.

4. xuLzh Ve vu ytuzoh / zebtLz z[tVx&e aqfJJtlehnuNu. œhuf xuLzh œeX yjd xuLzh xuLzhVe ChJtle hnuNu.

5. ytuAe hfble xuLzh Ve, R.yub.ze. fu xuLzh Ve, R.yub.ze. ÂJltlt xuLzhtu hœct<j (fuLmj) dKtNu.

6. xuLzh mt&u BþfJtbtk ytJ<e yluoMxble, xuLzhle hfblt 1% «btKu cukf duhLxe / zebtLz z[tVx / vu ytuzoh / jtufj btRfh auf&e s

MJefthJtbtk ytJNu. œhuf xuLzh œeX yjd R.yub.ze. ChJtle hnuNu. R.yub.ze. hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb

btxu jtufj btRfh auf, rzbtLz z[tVx, vu ytuzoh fu cukf duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu

R.yub.ze.le hfb btºt rzbtLz z[tVx, vu ytuzoh fu ckuf duhkxelt MJYvbtk ytvJtle hnuNu.

7. cukf duhuLxe btºt ybœtJtœ Nnuhle s MJefthJtbtk ytJNu.

8. xuLzh Ve <&t R.yub.ze.le hfblt ze.ze./ aufle vtA¤ ftuLx[tfxh©eyu vtu<tle mkM&tlwk ltb <&t btuctRj lkch yJ~g jFJtltu

hnuNu. ftuLx[t¾xhu vtu<tle mkkM&tlt auf <&t ze.ze. xuLzh R~gw &gt <theF ctœlt s ytvJt.

9. Nh<e xuLzhtu hœ ct<j dKtNu.

10. stu xuLzhbtk MvÐ WÕjuF fhtguj ntug <tu atubtmtlu fthKu Ft<tfeg MËalt yLJgu ßgthu ßgthu ftb ck^ htFJtLþk &tg <u mbglu ftble

BþÆ<btk bshu ytvJtbtk ytJNu. vhkðþ yt yLJgu ftuE CtJ J^thtu ytvJtbtk ytJNu lne. sule ltuk^ >huf xuLzhh ujuJe.

11. xuuLzhtu ftuEvK fthK ytÃgt rmJtg MJefthJt fu lrnk MJefthJt <ule mkÃËKo m•tt BGþrlrmvj frbNlh©ele hnuNu.

12. xuLzhbtk stu ftuR mwDtht JDtht ntug <tu <u ykd xuLzh Ch<t vnujt AuÕju ÂœJmu rlg< JucmtRx y&Jt fauheyu sYhe <vtm fhelu s

13. mefgtuhexe zevtuÍex/ vVtuboLm duhuLxele hfb Yt. yuf fhtuz mwDele ykœtS< hfblt ftb btxu jtufj btRfh auf, rzbtLz z[tVx, vu

ytuzoh fu cukf duhkxelt MJYvbtk <&t Yt. yuf fhtuz&e Wvhle ykœtS< hfblt ftb btxu mefgtuhexe zevtuÍex/ vhVtuboLm duhkxele hfb

btºt rzbtLz z[tVx, vu ytuzoh fu ckufduhkxelt MJYvbtk ytvJtle hnuNu.

14. ytuljtRl yul-«tufgwh JucmtRx vh&e ChJtlt &<t xuLzhbtk ftuLx[tfxh/ yusLmeyu xuLzhle ntzo ftuvebtk CtJ Cgto Jdhle mne mefft

fhe mcbex fhJtle hnuNu. stu <ubtk CtJ Chuj nNu <tu <uJt xuLzh hœ fhJtbtk ytJNu.

15. dwsht< mhfth ©b,ftuiNÕg ylu htusdth rJCtd îtht XhtJ ¢btf:LED/WRT/e-file/11/2024/0293/M2 mraJtjg ,dtk^eldh

<t.15.02.24 lt XhtJ v{btKu yusLme/¢tuLx[fxhtulu îtht ©bgtude ftgœtle studJtR vhevqKo &tg <u mwrlµ< fhJtlwk hnNu.

16. mœh xuLzhbtk ” GST rl<e rlgb bwsc jtdw vzNu ” <u bwsc dK<he fhe xuLzhtu

zebtLz z[tVx / auf “BgwÂlÂmvj fÂb§h©e, ybœtJtœ” lt ltbltu fZtJJtu.

ybœtJtœ BgwÂlÂmvj ftuvtuohuNl

yu.yth.me. xuLzh- Nh<tu

1. yu.yth.me. xuLzhbtk Jfoytuzh ytÃgt ctœ ftb NY fhJtle mbgbgtoœtbtk ftuLx[tfxh îtht ftb NY fhJtle òK

fgto ctœ 24 fjtflt ftb NY lrn fhJtbtk ytJu <tu yLg ftuLx[tfxh vtmu btfuox hux&e ftuLx[tfxhlt Faou ylu

stuFbu ftbdehe fhtJJtbtk ytJNu.

2. ftuLx[tfxhlu Jfoytuzoh ytÃgt ctœ yu.yth.me. «fthlkw xuLzh ntuR ftble sYhegt< bwsc xujeVtulef òK fhe su

<u ftb NY fhJt fnuJtbtk ytJNu ylu su ftble òK fgtolt 24 fjtfbtk NY fhJtbtk lrn ytJu ylu rlg<

mbgbgtoœtbtk vwKo fhJtbtk lrn ytJu <tu su <u ytRxblt SOR CtJ&e 1.5 dKe vulÕxe Jmwj juJtbtk ytJNu.

3. ºtK fu J^w Jth Wvh bwscle yLg ftuLx[tfxh vtmu&e ftbdehe fhtJJtle Vhs vzNu ylu/y&Jt ºtK fu J^w Jth

vulÕxe fhJtle Vhs vzNu <tu <u mkstudtubtk ftuLx[tfxhlu çjufjeMx fhJtbtk ytJNu sule ykr<b m•tt

Bgw.frb¹lh©elu hnuNu.

AHMEDABAD MUNICLPAL CORPORATION

MAHANAGAR SEVA SADAN

Clause : 1 Contractor shall not employ any child having age 5 to 15 years as it is prohibited by Child Labour

Prohibition and Regulation Act 1986. Hon'ble Supreme Court has given certain guide lines and as per the guide lines. If

child labour is employed on the site work, the contractor shall have to deposit Rs. 20,000.00 (Rupees Tw enty thousand

only) in the child labour welfare fund. If the employer refuses to deposit then action will be taken for contempt of

Supreme Court Judgement and also will be prosecuted by concerned authority. Because of the breach of any provision of

child labour prohibition and regulation Act 1986 by the Contractor & Municipal Corporation becomes liable to pay any

amount then the Municipal Corporation shall recover the said amount from the contractor.

Clause : 2 The Standing Committee has decided to deduct 1/2% amount from each running bill as per its Reso. No.

1783 Date 06--02-97, but the Municipal Corporation Board has recently decided that the actual testing charge is taken and

the remaining amount is refundable at the time of final bill (As per Muni. Board Reso. No. 123 dated 25-02-97)

Clause : 3 Contractor has to follow prevailing Labour act and has to maintain labour register acordingly,and has to

follow other govt.rules.

Clause : 4 Quantity taken in tender are tentative and may differ as per execution of work. No claim shall be entertain

regarding QUANTITIES.

* MODIFICATION OF DOCUMENTS

Modification of specifications and correction/corrigendum in respect of the work if required will be made by A.M.C. The

same shall be placed on A.M.C website which may be downloaded by the tendrers enclosed along with the tender duly

signed. These shall form a part of tender. The tenderer shall not add or amend the text of any of the documents except

in so far as may be necessary to comply with any addendum.

* ADDENDAUM/CORRIGENDUM .

Addendum or corrigendum conveying any change or correction in respect of the work shall form the part of the

contract documents. The full consideration shall be given to such addendum or corrigendum or correction before submission

tender duly filled in by the contractor. Therefore, the contractor shall have to watch such addendum or corrigendum or

correction published by A.M.C through its website www.egovamc.com. Tenderes shall verify the number of addendum

issued and enclose the same with the tender documents,failing which the tender shall be liable for rejection and no any

complaint in respect to this shall be entertained under any circumstances.

Contractor's Sign Addl.C.E.(westzone)