Loading…
Loading…
Tender Value
₹3.5 Cr
EMD Value
₹3.5 L
Closing Date
27 Apr 2026, 6:00 pmClosed
Similar tender results from the same govt authority in the past 3 years.
Dy.City Engineer
Construction of Vyara type footpath and central verge at dhudheshvar mehndikuva and old shahpur area in shahpur ward Central Zone. (A.R.C.)
298628
CENTRAL ZONE E-Tender Notice No.18/2025-2026 Tender No.606
Open
Civil Works - Others
Ahmedabad
₹6,000
Municipal Commissioner, Ahmedabad
₹3.5 L
23 Apr 2026
23 Apr 2026
23 Apr 2026
27 Apr 2026
23 Apr 2026
Name of work: - Constuction of Vyara type foothpath and central verge at dhudheshvar mehndikuva
and old shahpur area in shahpur ward Central Zone. (A.R.C.)
Tender Invited on Behalf of AMC, Central Zone.
Assistant Manager, Central Zone,
Central Zone Zonal Office”, B – Wing,
Third Floor,Sardar Patel Bhavan,
Danapith, Ahmedabad-380001.
Signature of Bidder Page 2 of
AHMEDABAD MUNICIPAL CORPORATION
Notice inviting Tender
Competent authority on behalf of Municipal Commissioner of A.M.C. invites percentage rate sealed tenders from
interested contractors for the following work at different locations within the limit of A.M.C.
1 Name of work Constuction of Vyara type foothpath and central verge at
dhudheshvar mehndikuva and old shahpur area in shahpur ward
Central Zone. (A.R.C.)
2 Estimated Tender Amount Rs. 3,50,00,000.00 (EXCLUDING OF GST) GST WILL BE PAID
EXTRA BY AMC/AUTHORITY AT PREVALLING RATE TO
3 Tender fee Rs.6,000.00
(Non refundable) (Demand Draft in favour of Municipal Commissioner, Ahmedabad)
4 Time Limit 18 Months
5 Download of Tender Documents Tenders from the website www.nprocure.com or shall be down
loaded mentioned AS PER TENDER NOTICE INVITED
6 Required registration Register “A” class having in Road Works in PWD in Govt. R&B / CPWD /
AMC or equivalent register with any other state Govt. or institutions.
7 Earnest Money Deposit (Bid security) Rs.3,50,000.00 (Demand Draft / pay order / Bank Guarantee in favour
(1 % of Estimate put to tender) of Municipal Commissioner, Ahmedabad is to be submitted as
prescribed as below. Demand Draft/Bank Guarantee shall be from
approved list of AMC of banks and the issuing branch of bank guarantee
shall be of Ahmedabad city only and it should be valid for for 180 days.
Per AMC finance Dept . Circular No. 5 Dt. 5/5/2007 & F.D.
Circular No. 29 Dt. 7/8/2010 & attched ANNEXURE - 1 finance
dept.circular No-40 Dt.05/11/2020. E.M.D. shall be submitted
physically along with the Physical Submission when applicable.
8 Submission of EMD and Tender Fee & EMD should Submitted physically along with tender
Tender Fees documents as described in the invitation of tender should be submitted
to Assistant Manager- Central Zone, 3rd Floor, B – Wing, Sardar Patel
Bhavan, Danapith, Ahmedabad-380001.
Bid submitted without bid security & tender fee shall be treated as non
responsive and shall be summarily rejected.
9 Mode of sending the Tender The whole tender shall be submitted by two modes.
Documents • Whole tender shall be submitted only on www.nprocure.com
website as per Schedule mentioned in Notice inviting Tender.
• Tender Fee, EMD, technical bid and other relevant PQ Documents
as per check list given in tender shall be submitted physically in two
copies (Original & duplicate) in sealed envelope as per Schedule
mentioned in Notice inviting Tender.
10 Last date of receiving Tenders. As per Notice inviting Tender / Addendum / Corrigendum.
The tenders received after latest schedule date and time will not
Signature of Bidder Page 3 of
be entertained under any circumstances.
11 Submission of Price Bid The Price bid shall be submitted online only. The bidder shall fill
percentage rate on amount of BOQ online only until specified.
Price Bid shall be submitted physically duly signed & seal without
mentioning quoted rated, else it shall be considered as rejected.
12 Opening of Technical bid As per Notice inviting Tender / Addendum / Corrigendum.
13 Tender validity period 120 days from the last date of submission of Tender.
14 Security Deposit 5 % of Contract Value to be submitted in the form of (Demand Draft /
pay order / Bank Guarantee in favour of Municipal Commissioner,
Ahmedabad. Bank Guarantee shall be from approved list of AMC of
banks as per attched ANNEXURE - 1 finance dept. latest circular.
and the issuing branch of bank guarantee shall be of Ahmedabad City
only. The validity of the Security Deposit shall be up to valid till 90 days
beyond Date of completion of work.
The Security Deposit shall be payable in 10 days (for tenders upto
Rs.10.0 Lacs) or 15 days (for tenders of Rs.10.0 Lacs and above) from
date of receipt of LOI failing which interest @ 4% per annum will be
charged by AMC.
15 Deductions from Running Bills
a. Retention Money 2 % amount of each Running Bill shall be deducted as a Retention
Money. Such retention money shall be released in the final bill of the
b. Labour welfare cess Labour welfare cess as per the Act, 1996 (non refundable) shall be
deducted from each running bill.
16 Defect & Liability Period Not applicable in this case. If applicable than refer condition of contract
attached over rule as per form B-1 published by Government.
17 Compansation for Delay 10 % of the actual balance work after Time limit expired.
18 GST condition This rate shall be without GST. As Per New slab GST 18% Deputy paid
when finally estimate approval. as per circular no.38 Dt.21.11.2022
• All the circulars which were published by Authorities of AMC time by time will be applicable on said Tender and bound
to bidder with out any condition.
• Conditional tenders will not be accepted in any case. Municipal Commissioner reserves the rights to reject any or all the
tenders without assigning any reasons thereof.
• The authorized signatory holding Power of Attorney shall only be the Digital Signatory. In case authorized signatory
holding Power of Attorney and Digital Signatory are not the same, the bid shall be considered non-responsive.
Seal and Signature of the Bidder Add City Engineer
Date: Ahmedabad Municipal Corporation
Signature of Bidder Page 4 of
A.E. (On contractor’s Letter Head / certified with Stamp and Sign with Contact Detail)
TENDER DECLARATION FORM
Add City Engineer
Ahmedabad Municipal Corporation,
Name of Work:- Constuction of Vyara type foothpath and central verge at dhudheshvar mehndikuva and old shahpur area in
shahpur ward Central Zone. (A.R.C.)
I/We the undersigned have carefully gone through and clearly understood the Tender documents of above mentioned
project comprising of Notice Inviting tenders, Articles of Agreement, Scope of work, Definition of terms, notes
Instructions/Information to Bidder, Condition of Contract, special condition of contract, Appendices, Specifications, Bill of
Quantities, furnished by AHMEDABAD MUNICIPAL CORPORATION.
I/We do hereby offer to execute and complete the whole of the work within the time specified all in accordance with the
specification, designs, drawing and instruction in writing referred to in the said document and with such materials as mentioned
for, at the respective rates which I/we have quoted in the Price Bid or at such other rates as may be fixed under the provisions of
these conditions.
In the event of this tender being accepted I/We agree to enter into an agreement and when required, execute the
contract, according to your form 1 of agreement as or in default where of I/we bound myself/ourselves to forfeit the "Earnest
Money Deposit."
I/We understand that if I/We shall not enter in agreement within fifteen days or as decided by AMC from the date of
receipt of letter of acceptance, you will forfeit the earnest money paid by me/us and take necessary action as deemed fit.
I/We have enclosed a Demand Draft / Bank Guarantee as an “Earnest Money Deposit", for the sum as mentioned in NIT,
the full value of which is to be absolutely forfeited to the Employer If I/We fail to commence the work specified. Otherwise the
Employer shall retain the said sum, as on account of such Security Deposit as provided for in the aforesaid documents.
I/We agree not to employ sub-contractors other than those that may be approved in accordance with conditions in the
aforesaid documents.
I/We understand that Municipal Commissioner is not bound to accept the lowest or any tender, which are received. I /
We also understand & agree that Municipal Commissioner Reserves the right to allot number of tenders to successful bidders at
his sole discretion in case if I / We am/are lowest in more than one tender.
I/We am/are bound to execute the job if the work order is issued within 120 days from the date of opening of the
I am bound to execute the work by maintaining all Quality aspects/parameters mentioned in the tender terms and
conditions. I am also bound to submit all supporting Genuine Original documents as and when asked and if any discrepancy
found in such documents as well as in the executed Work with respect to Quality/Quantity at any stage of work or even after
completion of work, it will be solely my Responsibility. I am bound to prove originality of all documents submitted by me and if
Signature of Bidder Page 5 of
any Documents found false/fake then Municipal Commissioner/AMC has right to take any action/penalty/punishment against
I am also bound that if I/we, indulged into any malpractice and/or used any inferior quality and/or the construction of
road is found to be of an inferior quality under this contract than in such case Municipal Commissioner/AMC has right to debar/
blacklist permanently.
I/We agree to pay the Government income-Tax, GST/Sales-Tax (Central and State), Octroi duties, Royalty on material
(i.e. Aggregate, Sand etc.) And any other taxes prevailing and from time to time on such items on which the same are leviable
and the rates quoted by me/us are inclusive of the same.
Yours faithfully
Seal and Sign of Contractor
Signature of Bidder Page 6 of
INSTRUCTIONS TO BIDDERS
1. Scope of Bid
1.1 Competent authority on behalf of The Municipal Commissioner, Ahmedabad Municipal Corporation (referred to as
Employer in these documents) invites sealed bids for the construction of works (as defined in these documents and
referred to as “the work”) detailed in the table given in the Invitation for Bid (hereinafter called as IFB.) from competent
bidder. The bidders may submit bids for the works detailed in the table given in IFB.
2.0 Source of Funds
Ahmedabad Municipal Corporation has arranged the fund for this project.
3.0 Eligible Bidders
3.1 The Invitation for Bids is open to all eligible bidders meeting the eligibility criteria as defined in this tender.
3.2 All bidders shall provide Qualification Information and Forms of Bid mentioned in the Clause-14. An agency that has
been engaged by the Employer to provide consulting services for the preparation or supervision of the works, and any of
its affiliates, shall not be eligible to bid.
3.3 Any entity which has been declared as non-performing by NHAI / GoG / AMC or the firms those are blacklisted/
debarred for specified period by AMC, Governement of Gujarat, Government of India or any other entity controlled by
it, would not be eligible to submit the Bid.
4.0 Qualification of the Bidder
4.1 Requires registration:- Register as per Notice Inviting Tender having in Road Works in PWD in Govt. R&B / CPWD / AMC
or equivalent register with any other state Govt. or institutions.
5.0 DISQUALIFICATION
Even though the bidders meet the above mentioned qualifying criteria, they are subject to be disqualified if they have,
• Made misleading or false representations in the forms, statements, affidavits and attachments submitted in proof of
the qualification requirements; and/or
• Record of poor performance such as abandoning the works, not properly completing the contract, inordinate delays
in completion, litigation history, or financial failures etc. or debarring from AMC work etc.
• Tampered the bid document in any manner.
• Colluded with other prospective bidders for this work to arrive at quoted prices for the purpose of restricting
• Indulged in inducement of any official of AMC and/or their consulting engineer and other advisors in any manner
• Proposal not submitted in accordance with this tender.
• During validity of the proposal, or its extended period, if any, the bidder changes his commercial terms.
• The bidder qualifies the proposal with his own conditions.
• Proposal is received after due date and time.
• Commercial proposal is enclosed with the same envelope as technical proposal
• The envelope does not show on the outside the reference of bid and thus gets opened before the due date of
• The E.M.D. is not deposited in full and in the manner as specified in the clause of Earnest Money Deposit.
Signature of Bidder Page 7 of
• The tender is in a language other than English or dose not contains its English Translation in case of other
language adopted for tender preparation.
• The tender documents received are not duly signed by authorized person.
• The validity of tender is less than what is stated in the tender.
• Any of the page or pages of tender is/are removed or replaced.
• Any condition which affect the cost.
• If it is joint venture.
5.1 Debarment / Black listing
Notwithstanding the above, the Employer may debar or blacklist any of the bidder(s) for their misleading or
false representations in the forms statements etc. for the period to be decided by the Employer.
6.0 Cost of Bidding
The bidder shall bear all costs associated with the preparation and submission of his Bid. Employer will in no case be
responsible and liable for those costs.
The Bidder, at his own cost, responsibility and risk, is encouraged to visit, examine and familiarize himself with the site of
Works and its surroundings including source of earth, water, road aggregates etc. and obtain all information that may be
necessary for preparing the Bid and entering into a contract for construction of the Works. The costs of visiting the Site
shall be at the Bidder's own expense.
8.0 Bidders shall not have any dispute or claim for any kind of compensation in case of,
• If the quantity stipulated in the tender items varies or the scope of work changes and thereby total amount of work
• If the quantity stipulated in the tender items varies or the scope of work changes and thereby total amount of work
increases / decreases up to any extent.
• If the works gets delayed / postponed for some administrative / technical decision whatsoever.
• If the items stipulated in the tender shall not be executed as per site condition/ requirements. No claim shall be
entertained for the same.
• No idle charges shall be paid to contractor for machinery and man power if remain idle and no claim shall be entertained
B. BIDDING DOCUMENTS
9.0 Content of Bidding Documents
9.1 The set of bidding documents comprises the documents listed below and addendum (if any) issued.
1. Notice inviting e-Tender
2. Special conditions of Contract
3. Instructions to Bidders
4. Qualification Information
5. Conditions of Contract
6. Technical Specifications
7. Forms of Bid
8. Bill of Quantities
• The bidder is expected to examine carefully all instructions, conditions of contract, contract data, forms, terms, technical
specifications, forms, Annexes in the bid document. Failure to comply with the requirements of bid documents shall be
at the bidder’s own risk. Bids which are not substantially responsive to the requirements of the bid documents shall be
Signature of Bidder Page 8 of
10.0 Amendment of Bidding Documents
10.1 Before the deadline for submission of bids, the Employer may modify the bidding documents by issuing addendum.
10.2 Any addendum thus issued shall be part of the bidding documents and shall be placed on website www.nprocure.com
The prospective bidder shall refer to website to check any addendum before 24 hours of opening of bids. AMC will not
give any advertisement for the same.
10.3 To give prospective bidders reasonable time in which to take an addendum into account in preparing their bids, the
Employer may, at his desecration, extend as necessary the deadline for submission of bids.
10.4 Prospective bidders should attach the addendum made for the work & if fails to do so than also the changes made
through such addendum shall be applicable & bound to the bidder.
C PREPARATION OF BIDS
11.0 Language of the Bid
All documents relating to the bid shall be in the English language only.
12.0 Documents comprising bid
The e bid submitted by the bidder shall be in two separate parts.
• Technical Bid
• Financial Bid
To qualify for award of the contract, each bidder must submit the following documents along with bid:
• Required Registration Certificate
• Other requested documents
• Any other material / information required to be submitted in accordance with these Instructions to Bidders (ITB)
Failure to submit these certificates/documents shall make the bid non-responsive.
Above original documents in physical form in two copies, one marked as “original” and other marked as “Duplicate”,
shall be submitted in a sealed envelope by 18:00 Hrs on the date of physical submission of bid and addressed to the
addressee given in the NIT duly super scribed “Name of Work, Bid due date and time, Name and address of the bidder”
13.0 Bid Prices
• The contract shall be for the whole works as described in Bill of Quantity based on the percentage rate in the Bill of
Quantities submitted by the bidder..
• All duties, taxes, and other levies payable by the contractor under the contract, or for any other cause shall be included
in the rates, prices and total Bid Price submitted by the Bidder, except otherwise stated in the Bid document.
Employer will not compensate the bidder (contractor) for any change in duties, taxes and other levies payable by the
contractor under the contract and any other reasons.
• The percentage rate and bid price quoted by the bidder shall be fixed up to the completion of Work and shall not be
subject to adjustment on any account, except where expressly specified, otherwise, in the contract.
14.0 Currencies of Bid and Payment
The currency of bid and payment shall be in Indian Rupees. All payments shall be made in Indian Rupees.
Signature of Bidder Page 9 of
15.0 Bid Validity
15.1 Bids shall remain valid for 120 days from last date of submission of tender. A bid valid for a shorter period shall be
rejected by the Employer as non-responsive.
15.2 In exceptional circumstances, prior to expiry of the bid validity (120 days), the Employer may request that the bidders
may extend the period of validity for a specified Deputy period. The request and the bidders' responses shall be made in
writing or by cable. A bidder may refuse the request without forfeiting his bid security. A bidder agreeing to the request
will not be required or permitted to modify his bid, but will be required to extend the validity of his bid security for a
period of the extension.
16.0 Earnest Money / Bid Security
16.1 The Bidder shall furnish, a Bid Security of the amount as shown in the Table of IFB as part of his bid, in the form of
Demand Draft / pay order / Bank Guarantee in favour of Municipal Commissioner, Ahmedabad valid for 120 days.
16.2 The issuing branch of the bank guarantee shall be of Ahmedabad City only.
Signature of Bidder Page 10 of
16.3 Any bid not accompanied by an acceptable Bid Security shall be rejected by the Employer as non-responsive.
16.4 Any bid having bid security for lesser value and shorter validity period shall be treated as non-responsive.
16.5 (a) The bid security of the unsuccessful bidders, except for L1, L2 and L3 bidders will be returned as promptly as possible.
(b) The bid security of the successful bidder, along with second and third lowest tenders, will be returned when the
successful bidder has furnished the required security deposit and signed the agreement.
16.6 The Bid Security of the Successful Bidder will be discharged when the bidder has signed the Agreement and furnished
the required security deposit.
16.7 The Bid Security shall be forfeited,
a) if the Bidder withdraws the Bid after Bid opening during the period of Bid validity;
b) in the case of a successful Bidder, if the Bidder fails within the specified time limit to
Signature of Bidder Page 11 of
(i) sign the Agreement; or
(ii) Furnish the required security deposit.
(iii) commence the work after signing the agreement within 15 days
16.8 No interest shall be paid by the owner on any tender guarantee. The issuing branch of the bank guarantee shall be of
Ahmedabad City only.
16.9 Bank Guarantee for Earnest Money Deposit should be executed on non-judicial Stamp papers of requisite value in
accordance with the stamp Act applicable to that particular state of Indian Union, where executed.
16.10 The executing officers of the bank Guarantee for Earnest Money Bid Security shall clearly indicate in (block letters) his
name, designation, Power of Attorney No. / Signing Power No. etc.
16.11 Each page of the bank guarantee for Earnest Money Deposit shall be duly signed/initialed by the executing officers and
the last page shall be signed in full, indicating the particulars as aforesaid under the seal of the Bank.
D. SUBMISSION OF BIDS
17.0 Sealing and Marking of Bids
17.1 The bidder shall submit the Technical Bid only. The Bid shall be sealed in separate envelopes and the three sealed
envelopes shall be sealed in an outer envelope. The Bid envelopes shall be marked as follows:-
• Complete Tender Document with all necessary qualification related documents (in two copy)
Above two envelopes shall be kept in one envelope and it should be marked as “Technical Bid” and sealed. This Outer
envelope should mention the name of firm of bidder, his address, contact details & name of the work.
17.2 The inner and outer envelopes
a) Shall be addressed to the Employer at the following address:
Assistant Manager- Central Zone,
3rd Floor, B – Wing, Sardar Patel Bhavan,
Danapith, Ahmedabad-380001.
c) Bear the following identification:
Indicate the name and address of the bidder.
• If the outer envelope is not sealed and marked as above, the Employer will assume no responsibility for the
misplacement or premature opening of the bid.
18.0 DEADLINE FOR SUBMISSION OF THE BID
18.1 Complete Bids (including Technical bid and necessary documents) must be received by the Employer at the address
specified in bid information not later than the date indicated on the face sheet of the document. In the event of the
specified date for the submission of bids declared a holiday for the Employer, the Bids will be received up to the
appointed time on the next working day. The Bidder is further required to submit Documents in Physical Form on or
before the Bid Due Date and before the time of submission as specified in NIT, at the following address:
Assistant Manager- Central Zone,
3rd Floor, B – Wing, Sardar Patel Bhavan,
Danapith, Ahmedabad-380001.
Signature of Bidder Page 12 of
18.2 AMC assumes no responsibility for inability of a bidder to submit bids through (n) procure e-tendering portal on account
of delay in submission at bidder's end. Bidder shall ensure that they submit the bid well before the "Due Date & Time of
Bid- Submission". AMC shall not be responsible if bidder is not able to submit the bid on account of failure in
network/internet connection or any other technical reason.
18.3 The Employer may extend the deadline for submission of bids by issuing an amendment in accordance with respective
Clause, in which case all rights and obligations of the Employer and the bidders previously subject to the original
deadline will then be subject to the new deadline.
18.4 All bidders are requested to see the website of (n) procure for amendment / corrigendum if any.
18.5 Any Bid received by the Employer after the deadline prescribed in NIT will be rejected and returned unopened to the
Any Bid received by the Employer after the deadline prescribed in NIT will be returned unopened to the bidder.
20.0 NOTIFICATION OF AWARD & SIGNING OF AGREEMENT
The Bidder whose Bid has been accepted will be notified of the award by the Employer prior to expiration of the Bid
validity period by writing, facsimile or e-mail confirmed by registered letter. This letter (hereinafter and in the Conditions
of Contract called the “Letter of Acceptance” will state the sum that the Employer will pay the Contractor in
consideration of the execution, completion, and maintenance of the Works by the Contractor as prescribed by the
Contract (hereinafter and in the Contract called the “Contract Price”).
The notification of award will constitute the formation of the Contract, subject only to the furnishing of a Security
Deposit in accordance with the provisions of Clause.
The agreement will incorporate all correspondences between the Employer and the Successful Bidder. It will be signed
by the Employer and the Successful Bidder.
21.0 SIGNING OF CONTRACT AGREEMENT
21.1 The Employer and the successful bidder shall enter into a Contract Agreement within 28 days after the successful bidder
(hereinafter called the Contractor) receives the Letter of Acceptance, unless they agree otherwise, subject to furnishing
the security deposit before signing the Agreement with the Employer.
21.2 Upon issue of ‘Letter of Acceptance’ to the successful Bidder, the Employer will promptly notify the other Bidders that
their Bids have been unsuccessful and release their Earnest Money Deposit / Bid Security.
22.0 SECURITY DEPOSIT
22.1 Within 15 days of receipt of the Letter of Acceptance, the Successful Bidder shall deliver to the Employer a security
deposit in the form of Bank Guarantee for an amount equivalent to 5% of the Contract Price valid for the period of valid
till 90 days beyond Date of completion of work. The Security Deposit shall be payable in 10 days (for tenders upto
Rs.10.0 Lacs) or 15 days (for tenders of Rs.10.0 Lacs and above)from date of receipt of LOA failing which interest @ 4%
per annum will be charged by AMC.
22.2 The security deposit shall be in the form of a Bank Guarantee in the name of the Employer, from Ahmedabad branch of
any Banks mentioned in the clause no. 16.2 of these tender documents.
22.3 This security deposit shall be released only after the clearance of final bill including pre & post Audit.
22.3 Interest @ 4 % per annum shall be deducted from contractor in case of late submission of security deposit or late
renewal of bank guarantee for the number of days delayed for submission or discontinuity of the bank guarantee.
Signature of Bidder Page 13 of
22.4 Bank Guarantee to be submitted in the prescribed format enclosed and shall be same verbatim as per the format. Bank
Guarantee shall be submitted on right value of stamp paper and for correct value of contract.
22.5 Failure of the Successful Bidder to comply with the requirements of Sub-Clause 22.1 shall constitute sufficient grounds
for cancellation of the award and forfeiture of the Bid Security.
22.6 In case of any contract amendment during execution of the contract enhancing value of the contract the BG value shall
be enhanced accordingly. Validity of BG shall be commercial terms and conditions of the tender.
22.7 All compensation or other sums of money payable by the Contractor to the Employer under the terms of this Contract or
any other contract or on any other account whatsoever may be deducted from Security Deposit. Also in the event of the
Contractor's Security Deposit being reduced by reasons of such deductions, as aforesaid, the Contractor shall, within
days of receipt of notice of demand from the Engineer-in-Charge, make good the deficit in Security Deposit.
22.8 Should there arise any occasion under the Contract due to which the periods of validities of Bank Guarantees as may
have been furnished by the Contractor from time to time, are required to be extended/renewed, the Contractor shall
get the validity periods of such guarantees extended/renewed, and furnish these to the Engineer-in- Charge one month
before the expiry date of the aforesaid Guarantees originally furnished failing which the existing Bank Guarantees shall
be invoked by the Engineer – in – charge. Also in case of any deficit in securities on any account as might occur or is
noticed, the Contractor shall forthwith recoup/replace the same with acceptable Security Deposit.
22.9 The Bank Guarantee shall be extended within the expiry dates wherever activities as per contract are not completed in
22.10 The Security Deposit less any amount due shall, on demand, be returned to the contractor after 45 days of completion
date / Final Bill paid date which ever is later. No interest on the amount of Security Deposit shall be paid to the
Contractor at the time of release of Security Deposit as stated above.
22.11 The successful bidder to whom ‘LOA’ has been issued shall enter into an agreement at Employer’s office within 15 days
23.0 Advance Payment and Security
The Employer will not provide any advance payment.
24.0 Dispute Review Expert
In case of all the disputes, decision of the Municipal Commissioner, Ahmedabad shall be final and binding to the bidder.
25.0 LITIGATION HISTORY
The applicant should provide accurate information on litigation and/or arbitration resulting from Contractors completed
or under execution by him over last five years. If the details of Litigation History are hidden by the Bidder and later on it
comes to the knowledge of the Employer, the Bidder shall be disqualified for the proposed work and other appropriate
actions shall be taken against the bidder.
DETAILS OF COMPLETED / ONGOING LITIGATION / ARBITRATION
Employer Value of the Reasons/Details for Remarks showing
Year Name of Project (Rs.) litigation/arbitration Present Status
Signature of Bidder Page 14 of
The bidder shall furnish separate table for individual project.
The above information shall be supported with necessary documents otherwise the same shall be treat as null and void.
A consistent history of arbitration awards? Judgments against the applicants or any partner of a joint venture may result
in disqualification for proposed work.
If the details of litigation History is hidden by the applicant and later on it comes to knowledge of the employer the
bidder shall be disqualified for the proposed work and other appropriate actions shall be taken against the bidder.
Seal and Signature of the Bidder Add City Engineer
Date: Ahmedabad Municipal Corporation
Signature of Bidder Page 15 of
GENERAL CONDITIONS OF CONTRACT
1.0 Liquidated Damages
1.1 If the Contractor fails to complete the works within the original or extended time limit, the Contractor shall pay penalty
of 10% of amount of actual remaining work. The amount of work for which the scope of contractor is reduced shall not
be considered for the calculation of Liquidated Damages.
1.2 Conditions mentioned in the AMC Finance Department Circular AMC no. 18 Date: 23/05/2017 and all latest Circulars
shall be applicable.
2.0 Retention Money
2 % amount of each Running Bill shall be deducted as a Retention Money. Such retention money shall be released in the
final bill of the said work. AMC reserves right to deduct any amount to compensate the poor performance of the
contractor i.e. poor quality or abandoned / incomplete work.
3.0 Subcontracting
3.1 Except where expressly specified in the Contract, the Contractor shall not subcontract any portion of Work without the
approval of the Employer’s Representative. Any subcontracting shall not relieve the Contractor from any contractual
obligations or responsibility under the Contract.
3.2 The Contractor shall not be required to obtain consent for a subcontract for which the name of the subcontractor and
scope of works activities to be performed by him is already stated in the contract or supply of material or engagement of
4.1 The Contractor shall employ the key personnel named in the Schedule of Key Personnel as referred to in the Bid document
to carry out the functions stated in the Schedule or other personnel approved by the Engineer. The Engineer will
approve any proposed replacement of key personnel only if their qualifications, abilities, and relevant experience are
substantially equal to or better than those of the personnel listed in the Schedule.
4.2 If the Engineer asks the Contractor to remove a person, without assigning reasons thereof, for his misconduct or
inadequacy of technical skills and experience, who is a member of the Contractor’s staff or his work force, the
Contractor shall ensure that the person leaves the Site within seven days and has no further connection with the work in
4.3 No residential accommodation is allowed at the site of work. The labour huts shall not be erected on the site of work and
contractor shall make his own arrangements to provide such accommodations as per the rules of the local bodies. He
shall make his own arrangements for housing, stores, field office etc. He shall submit a site layout plan indicating the
location of various site facilities to be created by him at his cost for the execution of work. The Owner shall in no way be
responsible for any delay on this account and no claim on this account whatsoever shall be entertained. All Basic
amenities shall be provided by the Contractor to Labours as per the prevailing labour Laws.
5.1 The Contractor shall have full regard throughout execution, completion and defects liability period to following safety
aspects and shall take all necessary steps to ensure that danger to safety is avoided all the time in respect of,
Safety of the works
• Safety of the Contractor’s employees and all the persons directly or indirectly engaged by him for the works
Signature of Bidder Page 16 of
• Safety of all the employees including persons working on other contracts of Employer at the same site of the
Employer and Engineers employees engaged at work site.
• Any authorized third party persons on the site.
• Contractor’s plant and equipment
5.2 The Contractor shall provide and maintain at his costs all lights, guards, fencing, warning signs, barricading, and cones;
when and where necessary, or required by Engineer in Charge or by any duly constituted authority for the protection of
the works or for the safety and convenience of the public or other.
5.3 The Contractor shall take all reasonable steps to protect the environment on and off the site and avoid damage or
nuisance to persons or property of the public and others arising as a consequence of his method of operation.
5.4 The Contractor shall maintain in good condition all work throughout execution, completion, and defects liability period.
The contractor shall be responsible for and to make good all injuries, damages and repairs, rendered necessary by fire,
rain, traffic, floods or other causes.
5.5 All the scaffolding work, wherever required for the execution of work, shall be provided by the contractor. Nothing extra
shall be payable on this account. It shall be provided strictly with double scaffolding system with all the accessories etc.
with adjustable suitable working platforms to access the areas, with ease for working and inspection. It shall be designed
to take all incidental loads. It should cater to the safety features for workmen. It shall be ensured that no damage is
caused to any structure due to scaffolding.
5.6 All temporary warning/ caution boards display shall be provided and displayed during day as well as night time by the
contractor, wherever required and as directed by the Engineer.
5.7 Arrangement of temporary water and electricity and telephone connection required, by him, shall be made by the
Contractor at his own cost and also necessary permissions directly from relevant Owners shall be obtained by him under
intimation to the Owner. Also all initial and running charges and security deposit, if any in this regard shall be borne by
him. The Contractor shall abide by all the rules/ bye laws applicable in this regard and he shall be solely responsible for
any penalty on account of violation of any of the rules and byelaws in this regard.
5.8 In any case if any fatal accident (major or minor) occurs due to poor safety precautions, the same shall be completely
contractor’s responsibility. All the losses due to such accidents and expenses of legal matters shall be borne by
5.9 The Contractor shall be responsible for maintenance and watch and ward of the complete installation and shall also be
responsible for any pilferage, theft, damage, penalty etc. in this regard. The Contractor shall indemnify the Owner
against any claim arising out of pilferage / theft, damage, penalty etc. whatsoever on this account.
5.10 The Contractor shall depute Site Engineer & skilled workers as required for the work. Necessary protective and safety
equipments shall be provided to them by the Contractor at his own cost and used at site.
6.0 Contractor to keep site clean:
During the execution of the work, the Contractor shall keep the site clean. All wreckage rubbish, excess materials,
temporary works no longer required will be removed from site immediately.
7.0 Clearance of site on completion:
The Contractor shall clear away and remove all Contractors equipment, surplus materials, rubbish, temporary works of
A. COST CONTROL
8.0 Bill of Quantities
Signature of Bidder Page 17 of
a. The schedule-B shall contain Memorandum showing items for the construction, installation, testing, and
commissioning work to be done by the Contractor.
b. The quantities stated in the schedule B are estimated quantities. The Contractor shall be paid only quantities
calculated after taking measurements of executed work. The rate stated in the schedule B for each item of work
shall apply. The works shall be measured by the Contractor jointly with the authorized representative of the
Engineer and all particulars required by the representative of the Engineer shall be supplied by the contractor.
c. The work shall be measured net. No allowance for general or local custom, working space etc. is to be made.
9.1 The Engineer in Charge shall have power to make any variation of form, quality or quantity of the works or any part
thereof that may, in his opinion, be necessary and for that purpose, or if for any other reason it shall, in his opinion, be
appropriate, he shall have the authority to instruct the Contractor to do and the Contractor shall do any of the following:
Increase or decrease the quantity of any work up to any extent included in the contract,
Omit any such work,
Change the character or quality or kind of any such work,
Execute Deputy work of any kind necessary for the completion of the Works or
Change any specified sequence or timing of construction of any part of work.
9.2 No such variation shall in any way vitiate or invalidate the contract, but the effects, if any, of all such variations shall be
valued in accordance with the following sub clauses. Provided that where the issue of an instruction to vary the Works is
necessitated by some default or breach of contract by contractor or for which he is responsible, any Deputy cost
attributable to such default shall be borne by the Contractor.
9.3 The Contractor shall not make any such variation without an instruction of the Engineer. No instruction is required for
quantities varying from those provided for the items in the contract schedule B.
10.1 The basis for the valuation of variations for addition to the Contract Price shall be as follows in the same order of
a) Variations in the quantities of work in schedule of quantities shall not vitiate the contract.
b) The contractor shall be bound to execute extra items of work as directed by the Engineer-in-charge.
c) Contract unit rates for individual items shall apply to varied quantities where there is a quantity variation.
d) The price variations on extra item will not be given.
e) In case of other non tender items following procedure shall apply.
10.2 If any extra item crops up during the progress of work the same shall be carried out by the Contractor and he shall be
paid at the rate fixed by Employer which shall be fixed as lowest of the rates derived by rate analysis based on the
following three methods. , the priority of the documents forming the Contract shall be as follows:
(i) If the extra item is included in the S.O.R. of Road & Building Department, Year 2013-14, the rate of extra item shall
be that rate and premium (above or below) quoted by contractor.
(ii) Rate analysis based on prevailing Govt. of Gujarat’s SOR rates.
(iii) Rate analysis based on current market rates. This shall be based on
The material costs, the labour costs, the cost of use of all plant, machinery and equipment, the cost of all
temporary and incidental works, the overheads and the Contractors profit.
The overheads shall be taken at 5 % of the sum of material costs, the labour costs, the cost of use of all plant,
machinery, and equipment, the cost of all temporary and incidental works.
10.3 In case of the rate is to be derived from prevailing market rate, the Contractors profit shall be taken at 10 % of the final
Signature of Bidder Page 18 of
10.4 In the event of disagreement, the Engineer in Charge shall fix such rates and prices as are, in his opinion appropriate and
shall notify the Contractor accordingly with a copy to the Employer.
10.5 The Engineer shall determine provisional rates and prices to enable on account payments to be included in the Interim
Payment Certificates, until rates and prices are agreed as final by the Employer, the Contractor, and the Engineer.
10.6 The Contractor shall not be entitled to Deputy payment for costs, which could have been avoided by giving early
11.1 Payments shall be adjusted for deductions for advance payments, retention, other recoveries in terms of the contract
and taxes at source, as applicable under the law. The Employer shall pay the Contractor the amounts certified by the
11.2 If an amount certified is increased in a later date certificate due to corrections in previous certificates or as a result of an
award from disputes review experts, Contractor shall be paid such amount only. The Contractor shall not be paid any
interest upon such delayed payment.
11.3 Items of the work for which no rate or price has been entered in will not be paid for by the Employer and shall be
deemed covered by other rates and prices in the Contract.
11.4 All payments shall be made in Ahmedabad.
12 Taxes and duties
12.1 The rates are inclusive of all the prevailing taxes and duties of the Central, State and Local Governing bodies prevailing
on the date of award of the contract. The Contractor will have to pay all such taxes and duties for the performance of
this Contract. The Employer will deduct from the Contractor’s monthly and other payments all taxes and duties, which
he is bound to recover in accordance with the applicable law.
12.2 The Contractor shall keep himself fully informed of all acts and laws of the Central & State and local Governing bodies,
all orders, decrees of bodies, tribunals having any jurisdiction or authority which in any manner affect those engaged or
employed, and anything related to carrying out the work. All the bye-laws lay down by AMC/AUDA and any other local
bodies while executing the work shall be adhered to. All taxes of local bodies shall be borne by the contractor. The
Contractor shall arrange to give all notices required by any authority and to pay to such authority all the fees that may
have to be paid for the material, plants, equipments etc. The Contractor shall also adhere to all traffic restrictions
notified by the local authorities. He shall protect and indemnify the Owner and its officials & employees against any
claim or liability arising out of violations of any such laws, ordinances, orders, decree, whether by himself or by his
employees or his authorized representatives. Nothing extra shall be payable on these accounts.
13.0 Labour Welfare Cess
As per circular No. GHR/2005/04/CWA/2004/841/M-3 dt. 3/1/05 and G.R. No. CWA/2004-1831-M(3) dt. 9/12/05 issued
by G.O.G. (non-refundable) shall be deducted from every bills which shall be deposited to Govt. Labour Department for
Labour welfare fund.
14.0 Currencies
All payments shall be made in Indian Rupees.
Signature of Bidder Page 19 of
15.0 Advance Payment
No Advance Payment shall be made.
16.0 Cost of Repairs
Loss or damage to the Works or Materials to be incorporated in the Works between the Start Date and the end of the
Defects Correction periods shall be remedied by the Contractor at the Contractor's cost if the loss or damage arises from
the Contractor's acts or omissions.
B. FINISHING THE CONTRACT
17.0 Completion
The Contractor shall request the Engineer to issue a Certificate of Completion of the Works and the Engineer will do so
upon deciding that the Work is completed.
18.0 Termination
18.1 The Employer shall be entitled to terminate the contract if the contractor:
(a) Fails to carry out any obligation under the contract.
(b) Without reasonable excuse fails –
1. To commence the works on site within the period stated in the Appendix to Bid after receipt by him of a Notice
to this effect from the Engineer/Employer after signing the agreement or
2. To proceed with the works, or any section thereof, within 28 days after received notice
3. Has failed to comply with a notice issued or an instruction issued within 28 days after having received.
4. Abandons the works or otherwise plainly demonstrates the intention not to continue performance of his
obligation under the contract.
5. Sub-contracts the works or assigns the contract without the specific prior written permission of the engineer.
6. Has failed to furnish the required securities or extension thereof in terms of the contract.
7. Becomes bankrupt or insolvent, goes into liquidation, has a receiving or administration order made against him,
compounds with his creditors, or carries on business under receive, trustee or manager for the benefit of his
creditors, or if any act is done or event occurs which (under applicable Laws) has a similar effect to any of these
18.2 In any of these events or circumstances, the Employer may, upon giving 14 days notice to the contractor, terminate the
contract and expel the contractor from the site. However, in the case of sub-paragraphs (h), the Employer may be notice
terminate the contract immediately.
18.3 The Employer’s decision to terminate the contract shall not prejudice any other rights of the Employer, under the
contract or otherwise.
18.4 After termination, the Employer may complete the works and/or arrange for any other entities to do so. The Employer
and these entities may then use any goods, contractor’s documents and other design documents made by or on behalf
of the contractor.
18.5 The Employer or the Contractor may terminate the Contract if the other party causes a fundamental breach of the
18.6 Fundamental breaches of Contract include, but shall not be limited to the following:
(a) the Contractor stops work for 14 days when no stoppage of work is shown on the current Program and the stoppage
has not been authorized by the Engineer;
(b) the Employer or the Contractor is made bankrupt or goes into liquidation other than for a reconstruction or
(c) The contractor fails to fulfill requirements;
Signature of Bidder Page 20 of
(d) the Engineer gives Notice that failure to correct a particular Defect is a fundamental breach of Contract and the
Contractor fails to correct it within a reasonable period of time determined by the Engineer;
(e) the Contractor does not maintain a security which is required;
(f) the Contractor has delayed the completion of works by the number of days for which the maximum amount of
liquidated damages becomes payable as defined in the Contract data;
(g) if the Contractor, in the judgment of the Employer has engaged in corrupt or fraudulent practices in competing for
or in the executing the Contract.
(h) For the purpose of this paragraph: “corrupt practice” means the offering, giving, receiving or soliciting of anything of
value to influence the action of a public official in the procurement process or in contract execution. “Fraudulent
practice” means a misrepresentation of facts in order to influence a procurement process or the execution of a
contract to the detriment of the Borrower, and includes collusive practice among Bidders (prior to or after bid
submission) designed to establish bid prices at artificial non-competitive levels and to deprive the Borrower of the
benefits of free and open competition.”
18.7 When either party to the Contract gives notice of a breach of contract to the Engineer for a cause other than those listed
above, the Engineer shall decide whether the breach is fundamental or not.
18.8 Notwithstanding the above, the Employer may terminate the Contract for convenience.
18.9 If the Contract is terminated the Contractor shall stop work immediately, make the Site safe and secure and leave the
Site as soon as reasonably possible and handover the site to the Employer including all materials and plant and
equipment existing there upon.
19.0 Contractor's own responsibility
The contractor is to set out and level the works and will be responsible for the accuracy of the same. He shall also be
responsible for the correctness of the positions, levels, dimensions, and alignment of all parts of the structures as per
instructions given to him. If at any time any error shall appear during the progress of any part of the work, the contractor
shall at his own expense rectify such error if called upon to the satisfaction of the Engineer in charge.
20.0 Overpayment & Underpayment
20.1 Whenever any claim Fifths payment of a sum to the Municipal Corporation arises out of or under this Contract against
the contractor the same may be deducted by the Municipal Corporation from any sum then due or which at any time
thereafter may become due to the contractor under this contract and failing that under any other contract with the
Municipal Corporation or from any sum due to the contractor with the Municipal Corporation (which may be available
with Municipal Corporation), or from his retention money, or he shall pay the claim on demand. The Municipal
Corporation reserves the right to carry out post payment audit and technical examination of the final bill including all
supporting vouchers, abstracts, etc.
20.2 The Municipal Corporation further reserves the right to enforce recovery of any over payment when detected
notwithstanding the fact that the amount of the final bill may be included by the Contractor.
20.3 If as a result of such audit and technical examination any over payment is discovered in respect of any work done by the
Contractor or alleged to have been done by him under the contract, it shall be recovered by the Municipal Corporation
from the contractor by way of all the means prescribed above or if any under payment is discovered by the Municipal
Corporation, any amount due to the contractor under this contract or under payment may be adjusted against any
amount then due or which may at any time thereafter become due before payment is made to the contractor from him
to the Municipal Corporation on any other contract account whatsoever.
21.0 Materials obtain from dismantling
Signature of Bidder Page 21 of
If the contractor, in the course of execution of work is called upon to dismantle any part for reasons other than on
account of bad or imperfect work, the materials obtained from dismantling will be the property of the A.M.C. and will be
disposed of as per instruction of Engineer-in-charge in the best interest of the A.M.C.
22.0 Dispute to be referred to Arbitrator
The disputes relating to this contract, so far as they relate to any of the following matters, whether such disputes arise
during the progress of the work or after the completion or abandonment thereof, shall be referred an independent
Arbitrator appointed by AMC as far possible in consultation with the agency if it is necessary and such disputes shall be
settled in accordance with the arbitration and conciliation Act.
(i) The rates of payment under clause 5 for any tools, materials and stores, in or upon the works of the site thereof
or belonging to the contractor or procured by him and intended to be used for execution of the work or any part
thereof possession of which may have been taken by the Engineer-in-charge under the said clause –5.
(ii) The reduction in rates made by the Engineer-in-charge under clause 9 from the items of works not accepted as
completed fully in accordance with the sanctioned specifications.
(iii) The rate of part of payment for any class of work which is included in the Deputy or altered work carried out by
the contractor in accordance with the instructions of the Engineer-in-charge under clause 14 and the rates for
which is to be determined under the said clause
(iv) The rates of payment for materials already purchased or agreed to be purchased by the contractor before
receipt of notice given by the Engineer-in-charge under clause 15 and/or amount of compensation payable to
the contractor under the said clause for loss in respect of such materials.
(v) The amount of compensation which the contractor shall be liable to pay under clause 17 in the event of this
failure to rectify, remove or reconstruct the work within the period specified in the written intimation or the
amount of expenses incurred by the Engineer-in-charge under the said clause17 in rectifying, removing or re-
executing the work or in removing and replacing the materials or articles complained of.
(vi) The reduction of rates as may be fixed by the Engineer-in-charge under clause 17 for the inferior work or
materials as accepted or made use of.
(vii) The amount of compensation payable by the contractor for damages as estimates and assessed under clause
(viii) The amount payable to the contractor for the work carried out under clause 33 in accordance with the
instructions and the requirement of the Engineer-in-charge in case where there are no specifications.
(ix) The awards declared by the arbitrator shall be speaking award giving reasons and calculations to every item of
claims. The decision will have to be implemented by all the concerned.
(x) In case of dispute leading to the contractor or Ahmedabad Municipal Corporation approaching on Court of Law.
It shall be within the jurisdiction where the site of work is situated.
The reference to arbitration proceeding under this clause shall not:
i) Entitle the contractor to stop the Affect the right of the Engineer-in-charge under clause 5 to take possession of all or
any tools, plants, materials and stores in or upon the works of site thereof belonging to the contractor or procured by
him and intended to be used for the execution of the work or any part thereof.
ii) Preclude the Engineer-in-charge from utilizing the materials purchased by the contractor in any work or from
removing such materials to other places, during the period the work is stopped or suspended in pursuance, of notice
given to the contractor under clause
iii) Progress of the work or the carrying out the Deputy or altered work in accordance with the provisions of clause 14 or
as the case may be, of clause
23.0 Drawings and Photographs of the Works
Signature of Bidder Page 22 of
23.1 The contractor shall do photography/ videography of the site as and when asked by AMC. No separate payment will be
made to the contractor for this. . The contractor shall have to submit the same in hard copy as well as soft copy as and
when demanded by the AMC.
23.2 No photograph of the works or any part thereof or plant employed thereon, except those permitted under clause 59.1,
shall be taken, or permitted to be taken by the Contractor or by any of his employees or any employees of his sub-
Contractors without the prior approval of the Engineer in writing. No photographs/ videography shall be published or
otherwise circulated without the approval of the Engineer in writing.
Seal and Signature of the Bidder Add City Engineer
Date: Ahmedabad Municipal Corporation
Signature of Bidder Page 23 of
yb>tJt> BGþrlrmvj ftuvtuohuNl
ftb btxuLþk xftJthe >hJt¤wk xuLzh ylu ftuLx[tfx
xuLzh btxule Nh<tu
(1) y:- yt xuLzh su <u Jdolt yb>tJt> BGþrl.ftuvtuohuNl y&Jt fuLî{ y&Jt htsg mhfthle btLg gt>elt ftuLx[fxhtu Che NfNu.
dJobuLxlt btLg ftuLx[tfxhu yb>tJt> BGþrl.ftuvtuohuNlbtk btLg ftuLx[tfxhtule gt>ebtk hSMxuNl fhtJJtlwk hnuNu.
c:- btLg ©uKelt ftuLx[tfxh <hefu ltuk^Kelwk «btKvºtle MJ «btKe< fhuj lfj xuLzh mt&u stuzJtle hnuNu.
f:- xuLzhhle jtgft<
ftb sJtc>th xuLzhh <ubs su xuLzhh mwaJuj ftuLx[tfxhle ©uKe ytJ<t ntug <ubs ftb fhJt mûtb ntug <ublu s
ytvJtbtk ytJNu. ftb ytv<t vnujt ftuLx[tfxhu ftb mk<tu»tfthf <ubs xtRb jebexbtk ÃþY fhJt sYhe mJj<,ylwCJ,
ûtb<t ylu VtgltLmegj hemtumo hsw fhJtlt hnuNu.
z:- yb>tJt> Bgwrlrmvj ctuzo XhtJ lk - 3836,<t.25/11/2011 &e b¤uj bkswhe ylwmth <&t mexe.Rsluh mh¾gwjh,lk
-17,<t.09/12/2012 bwsc yb>tJt> Bgwrlrmvj ftuvtuohuNlbtk ftuLx[t¾xh hSMxuNl Ve, heLgwyj Ve <&t yvd{uzuNl
Ve ylu btv>kztu ægtlbtk htFe <u bwsc ybj fhJtltu hnuNu.
E. xuLzh Ch<t vnujt xuLzhhu mtRx rlheûtK fhe juJwk. xuLzhh ftblt «fth, ngt< hM<t, vtKe btdo, mkath ylu JvhtNlt
ceò hM<tytu&e mk<wÐ ntuJtlwk btle juJtbtk ytJNu. xuLzhhu ftblu mtRx ylu rcÕzekd(fu su ftb fhJt, ftb ÃþY fhJt <&t
ftblt buRxulLm btxu cltJuj ntug).<ubs xuLzhhu yt mtRxlt ftb btxu, rcÕzekd btxu, gtzo, zevtu btxule søgt vtu<tle
he<u bu¤Je juJtle hnuNu. (xuLzhlwk ftb fhJt, ftb vwhwk fhJt <&t ftblt buRxulLm btxule søgt)
(h) yt ftble mbg bgto>t bubtuhuLzb (ltuxem RLJtRxuz xuLzh) btk sKtJuj «btKu le hnuNu.
(3) xuLzh Jujezexe rvhegz bubtuhuLzb (ltuxem RLJtRxuz xuLzh) btk sKtJuj «btKu le hnuNu.
(4) xuLzh Ch<e JF<u yluoMxble ChJtle hnuNu.
(5) xuLzh Vtubo
xuLzh Vtubo ylu ylwmwrabtkle >hufu >huf Ftje søgt xuLzh Chlthu Chuje yt mt&u btufjujt >M<tJus vh< fhJtlt hnuNu.
(6) ftuLx[tfxhtuyu leaule ctc<tu ft¤SÃËJof JtkaJt rJlk<e Au.
(1) ftuR fkvlelu ltbu xuLzh juJtbkt ytÔgwk ntug <tu fkvle J<e xuLzh vh mne fhlth Ôgrf<lu yr^f]< fh<wk bwFðgthltbwk xuLzh
mt&u hsw fhJtlwk hnuNu.
(2) Bgwrl.ftuvtuohuNllt «Joðbtl rlgbtu ylwmth yluMxble ChJtle hnuNu.ylu xuLzh mt&u cezJtle hnuNu.
Signature of Bidder Page 24 of
(3) ftuLx[tfxhu RLfbxuût mkckr^< vtl lkch <&t cukf zexuRj ytvJtle hnuNu.
(4) ftuLx[tfxh vtmu ydtWlt ylwCJt ykdult «btKvºttule lfj xuLzh mt&u hsw fhe NfNu.
(5) xuLzh Nh<tu ylu MvuNeVefuNl <&t CtJ vºtflt >huf vtlt ylu rJd<tu vh ftuLx[tfxhu mne fhJe.
(6) <btb mw^tht, AufAtf ylu Dwkxujt jFtK vh ftuLx[tfxhu xwkfe mne fhJe.
xuLzh Chlthlu sKtJJtbtk ytJu Au fu xuLzh >eM<tJustult jFtKbtk ftuR AufAtf fu VhuVth fhJt >uuJtNu lrn ylu ytJe
ftuR AufAtf fu VuhVth juJtNu lrn, <ultk jFtKbtk ftuR Cwj ntug <tu <ult vh l Dwkx<t Ftuxt jFtK fu ytkfzt vh Auftu
bthelu <ult mtawk jFtK fu ytkfzt MvÐ Wfju <u he<u jFJt. «ðguf mw^tht vh xwkfe mne fhJe.
(8) y:- xuLzh hsw fh<tk vnujt Ftm fhelu xuLzhbtk >NtoJuj mwaltytulwk vtjl fhJtbtk ytÔgw lrn ntug <tu xuLzh ybtLg
dKJtbkt ytJNu <ule ltuk^ juJt rJlk<e Au. J¤e yt Vtubolwk bwFv]ƒ ylu ftuLx[tfxhtult btdo>Nol btxu mtbtLg rlgbtu
ylu mwaltytu vK ft¤SvwJof JtkaJt rJlk<e Au.
(1) ftuEvK fthK >NtoÔgt rmJtg ftuEvK fu c^t xuLzhtu yMJefthJtltu n¬ yctr^< hnu Au.
(h) xuLzhhu ctujvtuELx vullt c>ju NtneJt¤e vul&e Chujt xuLzhtu ðþkh< s ybtLg dKJtbtk ytJNu.
c:- Wvhle ctc<tu Wvhtk< xuLzh leault mkstudtubtk <h< ybtLg XhJtlu vtºt &Nu.
(1) xuLzh Chlth, rlg< ftb y&Jt ftb btxu bkswh fhuj y&Jt CtJ vºtflt ftuR ftuz y&Jt vîr< y&Jt rJd<tubtk bwfuj
Nh< y&Jt mw^thtbtk ftuR VuhVth mwaJ<t ntug.
(h) xuLzhlwk ftuR vtlwk fu vtlt ftZe ltkÏgwk/ltkÏgt ntug fu c>ÕGþ / c>Õgt ntug.
(3) c^t mw^tht J^tht y&Jt atukxtzuje ftvjeytu Wvh xuLzh Chlthu xwkfe mne l fhe ntug.
(4) xuLzhbtk <ubKu ftuR AufAtf fhe ntug, ylu
(5) xuLzh Chlth y&Jt vuZele ctc<btk >huf Ctde>th y&Jt <u ykdulwk bwFðgthltbwk ^htJlth Ôgrf< mne l fhu y&Jt
xuLzhbt <u btxu htFJtbtk ytJuje søgtbtk mne/mneytu Wvh ftuR mtûteyu mtF fhe l ntug.
f:- Nh<e xuLzh MJefthJtbtk ytJNu lne.
z:- xuLzh MJefthJw, h> fhJw, ftulu ytvJw ylu fgt CtJ&e ytvJw <u ykdu Bgwrl. frb§h©eltu rlKog ytFhe hnuNu. ftuR
fthKmh stu ftuLx[tfxhlu ftb l ytve Nftg <tu <u ykdu ftuLx[tfxh ftuRvK «fthltu lwfNtle fu J¤<hltu nff>tJtuu fhe
NfNu lrn fu ftg>tfeg ftgoJtne yt ykdu &R NfNu lrn. xuLzh bkswh >ltu y&o ftb ytve >uJtLþk Au <uJtu &R NfNu
lrn.Nh<e xuLzh MJefthJtbtk ytJNu lne.
(9) rJmkdr< ylu rnmtc stud:
nt& ^hJtlt ftbtule ctc< >NtoJ<t CtJ vºtfbtklt sÚ&t ylu hfble ftuRvK Cwjawf leault rlgbtu
ylwmth mhCh fhJtbtk ytJNu.
Signature of Bidder Page 25 of
(1) xuLzh Chlthu >hlt Ftltbtk sKtJuj Nç>tu ylu ytkfzt Jåau ftuR ymkdr<lt fumbtk Nç>tuubtk sKtJuj hfb btLg
htFJtbtk ytJNu.
(2) yufb >h ylu sÚ&tlt Ftuxt dwKtfthlt fthKu ftble ctc<tu >NtoJ<e CtJ vºtflt Ftltbtk&e hfbbtk Cwj sKtg <tu
yufb >h btLg htFJtbkt ytJNu ylu >hlt yt^thu dwKtfth mw^thJtbkt ytJNu.
(3) yufblt Ftltbtk&e <ubs ytd¤ Fuka<t mhJt¤tle <btb Cwjtu mw^thJtbkt ytJNu.
(4) ctc<tu y&Jt mhJt¤t mtbu vwhu ytkfzu fhuj ftuR vK ctc< ægtlbtk juJtbtk ytJNu lrn.
(10) y:- ftbltu «tud{um mbgbgto>t bwsc fhJtltu hnuNu. yt mbgbgot>t 10 jtF mw^elt ftb btxu yuj.ytu.ytR. ytÃgt
<theF&e 10 r>Jm <&t 10 jtF &e Wvhltk ftb btxu yuj.ytu.ytR. ytÃg <theF&e 15 r>Jm&e NY &guj dKJtbt
ytJNu. <&t <u >hBgtl ftble 5% juFu zevtuÍex Che fhthvºt fhJtltu hnuNu.
xuLzhbtk ftuLx[t¾xh îtht Chujt CtJ <btb «fthlt su <u «J<o<t mhfthe xuût mrn<lt CtJ dKJtbtk ytJNu.
ylu <ubtk atjw ftb >hBgtl su ftuR VuhVth &Nu <ultu J^thtu awfJJtbtk ytJNu lrnk .
c:- mûtb m•tt îtht Yt.10,00,000.00 (>m jtF) mw^elt xuLzhle bkswheltu XhtJ vtzgt ct> (LOI) ytvJtbtk ytJNu
ðgth ct> r>l - 10 btk rm¾gtuhexe zevtuÍex sbt fhtJJtle hnuNu. rm¾gtuhexe zevtuÍex btuze ChJtlt rfMmtbtk
Bgwrl.ftuvtuohuNlbtk «Joðbtl rlgb ylwmth ftgoJtne fhJtbtk ytJNu.
f:- bkswh &guj xuLzhle mbgbgto>tbtk ftbdehe vqKo l &tg <tu bubtuhuLzb (ltuxem RLJtRxuz xuLzh) btk sKtJuj «btKu
bkswh &guj mbgbgto>t ct>lt FhuFh ctfe ftble hfblt bn•tb 10% juFu (jefJezexe zubuSm) vulÕxe Jmwj
z:- yu.yth.me. xuLzhbtk bkswh &guj sw>t sw>t yk>ts vifelt ftbtu Jfo ytuzoh b¤u&e NY fhJtlt hnuNu.
E:- yu.yth.me. xuLzhbtk ftb «btKu yk>ts hfb Bþsc mbgbgto>t dKtNu.
(1) Yt.1,00,000.00 &e 3,00,000.00 Mþ^elt ftbtu btxu 1 btm
(2) Yt.3,00,000.00 &e 5,00,000.00 Mþ^elt ftbtu btxu 2 btm
(3) Yt.5,00,000.00 &e Wvhlt ftbtu btxu 3 btm
(11) y:- awfJKe:-
xuLzh Chlthu yu Jt< mbS juJtle hnuNu fu <uKu xtkfujt >h vwhtk &gujt ftb btxult Au ylu <ubtk bswhe, vtjF, ÃjtLx,
>uFhuF, mhJem-ftbdehe, Jes¤e, htugÕxe ylu ytufx[tug Jduhu ykNu <btb Faoltu <&t sYh sKtg <tu ylu ðgthu
ht<vt¤elt ftblu juJt c^t J^thtlt Faoltu mbtJuN &Nu ylu xtkfujt CtJ fu >h fh<t J^thtle ftuR awfJKe ykdult
<ublt ftuR >tJt ægtlbtk juJtNu lnek ylu xuLzh Chlth Ftuxe hswyt<lu fthKu y&Jt ftuR Ôgrf<yu (vAe<u ctk^ftb
rJCtdltu fboathe ntug fu l ntug) <ublu ytvuje btne<elu yt^thu vtA¤&e ftuR >tJt> hsw fhJt nf>th hnuNu lnek.
Signature of Bidder Page 26 of
<ublw xuLzh ChJt <&t <ubtk sw>t sw>t CtJ ylu >h ChJt btxu sYhe yuJe <btb btne<e vtu<tlt vûtu l bu¤Je NfJtlu
fthKu vtu<u xuLzh hsw fhJtlu je^u y&Jt <ubtk&e WCt &<t ftuR stuFb fu sJtc>thebtk&e Axfe NfNu lnek. m>h ftbbtk
ftuR vK ò<lt ctk^ftblt bxehegj Wvh CtJ J^thtu ytvJtbtk ytJNu lrnk.
c:- ftuLx[tfxhtulu vubuLx / hlekd cej Bgwrl. frb§h©elt su <u «J<obtl rlgb bwsc fhJtbt ytJNu. <&t Bgwrl.
frb§h©e/mexe Rsluh©e lt su <u JF<ltk mh¾gwjh «btKu ftbdehe/ybj fhJt rcl Nh<e ckDlf<ot hnuNu.
f:- ftuLx[t¾xhlt >huf hlekd cejbtk&e ftuLx[t¾xhlu awfJJtle &<e fwj hfb Wvh (xuLzh bwsclwk vubuLx + yu¾x[t ytRxb)
% juFu hexulNl ble ftvJtbtk ytJNu su VtRlj cejbtk vh< ytvJtbtk ytJNu.
z:- htsg / fuL÷ mhfth©elt JF<tuJF<lt ftg>t bwsc su ftuR hfble fvt< fhJtle &Nu <u bwsc ftuLx[tfxhlt cejbtk&e
fvt< fhJtbt ytJNu.
(12) yu:- fhth mkc^e >M<tJustu fhthlt ydðglt Ctd dKtNu ylu <u mD¤t mne<lt fhth mbd{ ftblu jtdw vzNu.
ce:- xuLzhbtk >NtoJuj ftb mkck^e >M<tJusbtk >NtoJuj rJd<btk rJmkd<<tlt rfMmtbtk leau >NotJuj ¢btlwmth >M<tJusbtk
>NtoJuj rJd< d{tng htFJtbkt ytJNu.fhth mkc^e >M<tJustu fhthlt ydðglt Ctd dKtNu ylu <u mD¤t mne<lt
fhth mbd{ ftblu jtdw vzNu.
(yu) yufb ylu f>:-
(2) xuLzh VtuboLþk CtJvºtf
(3) MvuNeVefuNl
z[tu#dbtk f>, ytfth, ytkfzt f>ta Ftuxt ntug <tu btvujt f>, ytfthlu yLþmhÔþk
(2) xuLzh Vtubole yLþMþra-ce
(3) MvuNeVefuNl
Cwj Chujt fu Ftuxt JKollt rfMmtbtk yt mkck^e Wvhefûttyu rJmkd<<t ykdule ltuk^ bwfe yuze.mexe
yuLSlegh / zu.BGþrl.frbNlh©ele bkswhe bu¤JJtbtk ytJNu ylu <u bwsc fhJtbkt ytJuj rlKog ykr<b dKJtbkt
(13) xuLzhhu z[tuRkd fu MvuNeVefuNlbtk hnuje ftuR ûtr< fu Ftbeltu duhjtC juJtle fturNN l fhJe ylu Rsluh Rlatsuo Ãjtl
<&t MvuNeVefuNlle ûtr<ytu mw^thJe <&t <ulwk mtawk y&oDxl fhtJJwk.
(14) yt Wvhtk< y.Bgw. ftuvtuo. lt slhj ftuLx[tfx fLzeNl vK btLg htFJle hnuNu.
(15) yufe JF<u yuf fh<t J^w søgtytuyu ftb NY fhJtltu Jfo ytuzoh b¤u <tu ftb yuf mt&u s c^u NY fhJw vzNu.
Signature of Bidder Page 27 of
(16) atjw ftbu mrJom jtRllu lwfNtl l &tg <u he<u ftb fhJtlw hnuNu. stu ftuR mrJom jtRllu lwfNtl &Nu <tu <ule mkvwKo
sJtc>the (òlbtj) ftuLx[tfxhle vtu<tle hnuNu. mtRx Wvh ftb >hBgtl bswhtu fu sl<tlt ftuR btKmlt òlbtj lu
lwfNtl &tg <ule sJtc>the ftuLx[tfxhle hnuNu. vtujem Vrhgt> &tg <tu <ule sJtc>the vK ftuLxtfxhle hnuNu. CuFz
Dme l vzu <ule sJtc>the vK vtujem Vrhgt>bt ftuLx[tfxhle hnuNu. CuFz Dme l vzu <u btxu mjtb<elt vdjt (suJt
fu >tuhzwk ctk^e bswh Ftztbtk W<thJt, mtuhekd ylu Mx[xekd fhJt rJduhu) je^t Jdh bsqhlu Ftztbtk W<thNu <tu ftuLx[tfxh
s vtujem Vrhgt>bt sJtc>th hnuNu ylu Bgwrl.ftuvtuohuNlltu ftuRvK MxtV ytlt btxu sJtc>th hnuNu lrn. ytxjwk
mbSlu s xuLzh ChJwk. bswhtultu rJbtu vK W<thJtu.
(17) bxehegÕm fu ceò xuMxed hevtuxo ftuLx[tfxhu vtu<tlt Fauo ftuvtuohuNl sKtJu <u søgtyu fhtJJtlt hnuNu. bxehegÕm
jtJJt fu jR sJtltu mkvwKo Fao ftuLx[tfxhu CtudJJtltu hnuNu.
(18) M&¤ vrhrM&r< / sYhegt< bwsc ftb fhtJ<t xuLzhlt ytRxblt sÚ&tbtk J^ ^x &tg <tu rlgb ylwmth <u ykdu ftb
fhJt ftuLx[tfxh ck^tgujt Au.
(19) mtRx vh jtJJtbtk ytJuj btj mtbtl hesufx fhJtbt ytJu <tu <whk< r>l 1btk vh< jR sJtltu hnuNu. yLg&t <ule
lwfNtlle sJtc>the ftuLx[tfxhle hnuNu.
(20) ftuLx[tfxhlu su ftuLx[tfx ytvJtbtk ytJu Au. <ubt mhfth©elt «Joðbtl rlgb bwsc ve.yuV/juch yufx <&t bswhtu <&t
MxtVle Jebt vtujeme jElu <ult ftg>tlw vtjl fhJtlwk hnuNu <&t yt ykdu Bgwrl.ftuvtuohuNl îtht su btne<e btkdJtbtk
ytJu <u ytvJtle hnuNu. bu.BGþrl.frbNlh©elt mh¾âwjh Bþsc sYhe ctknu^he vºtf ytvJtLþk hnuNu.
(21) ftuRvK ftg>tfeg jexeduNl yb>tJt> Nnuhle ftuxobt hnuNu.
(22) btj su <u Mxtumo Wvh y&Jt mtRx Wvh jtuftulu lz<h l &tg <u he<u mwalt bwsc W<thJtltu <ubs dtuXJJtltu hnuNu.
(23) ftuR vK mhfthe fhJuht ChJtle <btb sJtc>the ftuLx[tfxhle hnuNu.
(24) ftuLx[tfxh îtht xuLzhbt >NtoJuj MveNeVefuNl bwsc MxtLzzo bxehegÕm MvuNeVefuNl bwsc jtJJtlt hnuNu.<&t xuMxekd
fhtJJtlwk hnuNu.<&t y ykdu «Joðbtl Bgwrl.ftuvtuohuNlt rlgbtulw vtjl fhJtlw hnuNu.
(25) yt xuLzhbtk stu ftuR ytRxb hne dR ntug <tu <u y&Jt M&¤ M&e<e bwsc xuLzhbtk mbtJuN l ntug <uJe J^thtle
ftbdehe fhJtle &tg <uJt rfMmbtk Bgwrl.ftuvtuohuNlt «Joðbtl rlgb ylwmth J^thtle ytRxblt CtJ lffe fhJtbtk
ytJNu ylu <u bwsc awkfJKe fhJtbtk ytJNu.
(26) atjw ftb >hBgtl «tuxufNlle mkvwKo sJtc>the ftuLx[tfxhle hnuNu. subtk vevzt, >tuhzt Cgmwaf ctuzo, ÃjtMxef vèe,
rJ. ftuLx[tfxhu jtJJtlwk ylu mtaJJtlwk hnuNu. ylu ftuRvK yfMbt< &Nu <tu <ule mkvwKo sJtc>the ftuLx[tfxhle hnuNu.
(27) M&¤ Wvh atjw ftbdehe >hBgtl ftb fhlth ftuLx[tfxhlt bswh / fboathe y&Jt yLg Ôgrf<lt yfMbt<lt rfMmbtk
juch yufx bwsc fhJtle &<e ftgoJtne <&t vtujem ftgoJtnele sJtc>the ftuLx[tfxhle hnuNu.
(28) stu MxtV mqalt ytvu <u bwsc mwalt vtu&e ftuLx[tfxhu htFJtle hnuNu. <ubtk >hhtus fhuj ftbdehe <&t yr^ftheytuyu
ftb mw^thJt fu «tud{um J^thJtlt ltuk^ fhuj ntug <tu <ulwk ftuBÃjtgLm ytvJtlwk hnuNu ytJe ltu^lt sJtc l &gu fu <u
«btKu M&¤ Wvh ybj l &gu ftuLx[tfxhlu vulÕxe fhJtle m•ttt yuze.mexe yuLSlehgh©elu hnuNu.
Signature of Bidder Page 28 of
(29) >huf ytRxblt MvuNeVefuNl yb>tJt> Bgwrlrmvj ftuvtuohuNlltk bkswh &guj <&t btLg htFuj MvuNeVefuNl Nh<tu
bwsc hnuNu su ytRxbbtk MvuNeVefuNl l ntug <uJt mkstudtubtk yuze.mexe.yuLSlegh©eltu rlKog ytFhe
hnuNu.Jtuxhekd fhJtbtk lrn ytJu fu >hhtus J^thtltu zucheÍ WvtzJtbtk lrn ytJu <tu ftuLx[tfxhlt Fauo ylu sutFbu
Jdh ltuxemu Jtuxhekd fhtJJtbtk <&t zucheÍ WvtzJtbtk ytJNu ylu cejbtk&e hfb ftve juJtbtk ytJNu.
(30) juch JuÕVuh Vkz btxu ntjbtk htsg mhfth©eyu fhuj nwfb bwscle hfb cejbtk&e ftve juJtbtk ytJNu.
(31) atubtmtltu vehegz <t.15 swl &e 14 ytufxtuch Mþ^eltu dKJtbtk ytJNu. yt mbg >hBgtl ftuLx[tfxh îtht ftbdehe
fhe Nftg <ub l ntug <tu <u Bþscle xtEb jebex J^the ytvJtbtk ytJNu.
(32) muÕm xuût / Jux lkch / ve.yuV. ftuz lkch / vtl lkch / S.yum.xe. lkch rJduhu ftuLx[t¾xhu VhSgt< ytvJtlt hnuNu.
(33) ltbœth ftuxo îtht fhuj nwfb <ubs rlœuo»ttulwk awM<vKu vtjl fhJtlwk hnuNu. subtk z[ulus lu jd<tk ftb btk ftuRvK
mkkstudtubtk bNel ntuj / dxh btk btKmlu W<thJtu lnek <ubs buLgwyj M¾{uJSkd ykdule btdoœrNoft lwk vtjl fhJwk.
(34) mœh xuLzhle ytRxbtult CtJtu ltKt Ft<tlt mh¾gwjh lkk.38, <t.21/11/2022 <&t mûtb m<tle b¤uj bkkswhe
bwsc Syumxe rmJtg dK<hebtkk juJtbt ytJuj <&t «Jo<btl rlgb bwsc Syumxe awfJJt vtºt &Nu. su ægtlu jR
<btb rczomu xuLzhtu ChJtlt hunNu.
(35) mœh xuLzh ykk<od<olt ftb mkkjøl y.Bgw.ftuvtuo.btkk «Jo<btl <btb rlgbtu/mh¾gwjhtu jtdw vzNu, <ubs JF<tu JF<
<h mw^thtytu vK jtdw vzNu. suule ltuk^ jR xuLzhtu ChJtlt hunNu.
(36) mœh xuLzh yu.yth.me. «fthlw Au ytvlu mtukvJtbtkk yuxju fu ytv îtht ChJtbtkk ytJuj ftbdehelt sÚ&t bwsc mbg
bgtoœt lffe fhe yjd&e bkswh &guj ykœtsJtRs Jfo ytuzoh ytvJtbtkk ytJNu ylu mbg bgtoœtbtkk ftbdehe vqKo
fhJtlw awM< vKu vtjl fhJtlw hunNu.
(37) mœhnw ftbbtkk Jtuzobtkk sYhegt< bwsc ytuAtbtkk ytuAe xuLzhle Nh< bwsc bkkswh <h xuLzh vife yjd yjd
ykkœtsle bkkswhe bu¤JJtbtkk ytJ<e ntuR, ytuAtbtkk ytuAe yuf mt&u œN søgtyu sYhegt< bwsc ftbdehe NY fhJtle
Nh<u ylu <u «btKu bulvtJh, bNelhe, bxehegÕm <ubs ltkkKtfeg studJtRle vwh<t «btKbtkk ÔgJM&t fhe su <u xuLzhhu
xuLzh Cgto vqJuo ytdtu<Y ytgtuslle <igthe mt&u ftbdehe fhJtle &tg Au.
(38) y.Bgw.ftu. ltk ltKt Ft<tk îtht RlJzo lk. 4416 <t.20/12/2025 &e b¤uj mwalt bwsc Mxu. frbxe
<t.27/11/2025 ltk mwal «btKu ßgtk 50% hemtgfjucj çjtuf JtvhJtbtk l ytJ<t ntug, <ulwk cej bkswh fhJtbtk
lrnk ytJu. sule ftuLx[t¾xhu Ftm ltuk^ juJe.
Signature of Bidder Page 29 of
yufhthlwk Vtubo
(1) nwk/ybu yt&e yufhth fhwk Awk/fheyu Aeyu fu yt xuLzh hsw fh<tk vnujtk buk/ybu M&¤le bwjtft< je^e Au ylu
ftblu jd<t btjmtbtl, bswhe ylu ceS ctc<tulu jd<e M&trlf vrhrM&r<le ò<-btne<e bu¤Je Au.
(2) nwk/ybu yt&e yufhth fhwk Awk/fheyu Aeyu fu yt ftuLx[tfxhtule Nh<tu rJd<tu ylu xuLzhlu jd<t >M<tJustu
ft¤SvwJof yÇgtm fgtuo Au ylu <u bwsc <ultu ybj fhJt mkb< Awk/Aeyu.
ftuLx[tfxhle mne ylu rmfft
Signature of Bidder Page 30 of
TECHNICAL SPECIFICATIONS:
Following technical specifications shall be applicable to the relevant items of BOQ
FollowingtechnicalspecificationsshallbeapplicabletotherelevantitemsofBOQ
Earthworkincuttinginallsortsofsoil&murrum incldg.conveyaning,breakingclodsspreadingthestuffas&where dire. With in a lead
of 50 mt. from end of cutting.
ThemodeofpaymentforthisitemshallbeonCmt.Basis.
Conveyance charge of earth, lime, murrum, building rubbish, manure,garbage,
sludge,excavatedrock,fly ash,aggregates of any kind Includingspreading &
levelling etc. complete.
ThemodeofpaymentforthisitemshallbeonCmt.Basis.
Dismantlingthefollowingincludingloading,unloadinganddisposalofunserviceablematerialforallleadorasdirected byEngineer-In-
Chargeand stackingtheserviceable materialandbackfillingthe resultingtrenchesandpitscomplete.
a. centralverge-kerbstone.
b. Dismantlingtiledorstonefloorslaidinmortarincludingstackingofserviceablematerialanddisposalofunserviceablem
aterialwith all lead andlifts.
c. Demolition&disposalofunserviceablematerialwithallleadandliftforunreinforcedconcrete.
d. Demolitionofbrickwork&stonemasonryincludingstackingofserviceablematerialsanddisposalofunserviceablemat
erialswithalllead andlift(1)In cementmortar.
e. Demolitionincludingstackingofserviceablematerialsanddisposalofunserviceablematerialswithallleadandlift.(I)R.C
Signature of Bidder Page 31 of
Thedemolitionshallconsistofdemolitionofoneormorepartsofthestructureasspecifiedorshowninthedrawings.Demolitio
n implies taking up or down or breaking up. This shall consist of demolishing whole or part of work including all
relevantitemasspecified or shownin the drawings.
The demolition shall always be planned before hand and shall be done in reverse order of the one in which the
structure wasconstructed.Contractorisfully responsibleforproperandsafedemolition.
Necessary dropping, shoring and under pinning shall be provided for the safety of the adjoining work or property,
beleftintact,beforedismantlinganddemolishingistakenupandtheworkshallbecarriedoutinsuchawaythatnodamages
Signature of Bidder Page 32 of
iscausedtotheadjoiningproperty.
Wherever required, temporary enclosures or partitions shall also be provide 1. Necessary precautions shall be taken
to keep thedust nuisance downasandwhere necessary.
Dismantling shall be commenced in a systematic manner. All materials which are likely to be damaged by dropping
from a heightor demolishing roof, masonry etc. shall be carefully dismantled first. The dismantled articles shall be
properly stacked as directed.All materials obtained from demolition shall be the property of Government unless
otherwise d shall be kept in safe custody untilhanded over totheEngineer-in-charge.
Any serviceable materials, obtained during dismantling or demolition shall be separated out and stacked properly as
directed,withalllead andlift.Allunserviceablematerials, rubbishetc.shallbstacked asdirectedby theEngineer-in-charge.
Oncompletionofwork,thesiteshallbeclearedofalldebrisrubbishandcleanedasdirected.
Modeofmeasurements&payment:
Measurementsofallworkexcepthiddenworkshallbetakenbeforedemolitiondismantlingandnoallowanceforincreaseinbu
lk shall be allowed. The demolition of lime concrete shall be measured under this item. Specification for deduction for
voids,openingsetc.shall beonsamebasisasthat employedforconstructionofwork.
All work shall be measured in decimal system as fixed in its place subject to the following limits, unless otherwise
statedhereinafter : (a)Dimensionsshall be measured to thenearest 0.01 mt. (b) Area shallbe worked out tothe nearest
0.01 sq. mt.(c,d,e)Cubicalconnectionshallbe worked outto the nearest 0.01 Cu.m.
Therateshallincludecostofalllabourinvolvedandtoolsusedindemolishinganddismantlingincludingscaffolding.Therateshall
o include the charges for separating out and stacking the serviceable materials properly and disposing the
unserviceablematerials with all lead and lift. The rate also includes for temporary storing for the safety of the portion
not required to be pulleddownorofadjoiningpropertyandprovidingtemporary enclosuresorpartitions
whereconsidered necessary.
Therateshallbeforaunitofonecubic
metre.For Dismantlingof Tiled Floor:
The relevant specifications shall be followed except the dismantling of tiled or stone floors laid on mortars shall be
doneDismantling implies carefully taking up or down or these are fixed by nail screws bolts etc. the shall be taken out
with propertools.
Signature of Bidder Page 33 of
Modeofmeasurement&Payment:
Thesupportingmaterials suchas joints beams if
anyetc.shallbemeasuredseparately.Therateshallincludestackingtheunserviceablematerialsasdirectedwillleadandlift.
Therateshallbeforaunitof(a)RMT(b)one sq.Meter(C) CMT(d)Cu.m(e)Cu.m
Extra rate over item of excavation of earth for excavation of asphaltpavement / RCC of thickness up to 0.20 meter
includingdemolishing the asphalt carpet, metal, soiling/cutting Reinforcement etc. comp. with stacking the material as
directed. (a) upto 0.20 meter thickness (By Manual)(b) 0.20 to 0.30 meter (By any type ofBreaker Machine or R.C.C.Cutter
machine includingcost of operator, fuel, & transportation etc complete.(c) 0.30 meter & above (By any type of Breaker
Machine or R.C.C.Cuttermachineincludingcostofoperator,fuel,&transportationetc complete.
TheItemshallbecarriedoutasperItemdescriptionandasperinstructionofEngineer-in-
Chargeand/orhisauthorizedrepresentative.
Therateincludesthecostofexcavationofbituminousmacadami.e.bituminouslayersonlylikeDBM,BCetcincludingthelabours,t
ools,equipmentandallotherincidentalexpenses.NonBituminousSub-layer/Subbasearenotconsideredinthisitem.
Signature of Bidder Page 34 of
WorkshallbecarriedoutmanuallyorbyMachineryaspersiterequirements.Themode
ofpaymentforthisitemshall beon Smt. Basis.
Supplying and fixing of 380 mm H x 300 mm L x 200 mm B KerbblockforCentralVergeinM-20gradeusing20mm nominal
sizeblacktrapaggregateofSevaliya/Timbaor equivalentqualityforpre-castblocks,reasonablyexposed finish/
formwork,mouldwithwellequippedwithvibratory system forkerbstonesofapproveddesignincludingcuring, etc. complete, including
the cost of formwork etc. complete. The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level
on 5 cm thick sand bedding withnecessary equipments andmaterials. The rate shall also includethe
flushpointinginCM(1:3)foralljointsofthe kerbstones.Fillingofzarialonethesidesofthekerbstone fixedwith
Bituminousconcretemixedinproperpositionasdirected byEngineer inchange to form aportable mixture.In any case Gravel or such
type of materials shall not be allowed for productiona) Laying on 5 cm thick Sand Bedding
Thespecifictionoffollowingmaterialsshallbeconformingwithspecificationmentionedforrelaventmaterial/itemsinGeneraltech
nicalspecification for buildingworkofR&B DepartmentofGujarat.
WatershallconformtoM-
Gradedstoneaggregate20mm.nominalsizetoM-10
Contractor shall have to manufacture the blocks as per the dimensions given in the drawing. Specific machineries
usedtomanufacturetheprecastblocks.Thesemachineriesshouldbecompatibletoproduceblocksofrequiredstrengthanddim
ensions. The machineshallcontainhydraulicPressoradvanced
equipmenttogeneraterequiredcompaction&Gradeandfinish.Moulds/Steel Plates/ Dies of the machine shall be
dimensionally checked & to be got approved before commencing theproduction. Contractor shall prepare
proper Drying Yard for keeping the blocks before curing. The drying yard shall
Signature of Bidder Page 35 of
levelledandcoveredsothatnoshrinkagecracksareformed.Contractorshallprepareadequatesizecuringpondtocuretheblocks
fornotlessthan21Days.Noothermeansofcuringshallbeallowed.ThetechnicalspecificationofconcreteshallconfirmtoIS456-
Signature of Bidder Page 36 of
2000.TheconcretemixisnotrequiredtobedesignedandonlynominalmixasperIS:456-2000shallbefollowed.The
proportionoftheconcretemixshallbe1:1.5:3(1cement:1.5coarsesand:3gradedstoneaggregate20mm.nominalsize)by
volume.Concrete work shall have fairly exposed concrete surface or as specified in the item. The designation ordinary
25specifiedasperI.S.correspondsapproximatelyto1:3:6,1:2:4,1:1.5:3and1:1:2nominalmixofordinary
concrete,byvolumerespectively.Theingredientsrequiredforordinaryconcretecontainingonebagofcementof50Kg.by
weight(0.0342m3.)fordifferentproportionsofmixshallbeasperIS456-2000.Theproportionoftheaggregateforthekerb
stoneshallbemodifiedaspertheapprovaloftheengineer-in-charge.Thewatercementratiosshallnotbemorethanthose
specified as perIS.The cement ofthemix shallbe increased, ifthe quantity of water ina mix hastobeincreasedto
overcomethe difficultiesofplacement and compaction sothatthewater cement ratio specified inthe tableisnot
exceeded. The maximum size
ofcoarseaggregateshallbeaslargeaspossiblewithinthelimitsspecifiedbutinnocasegreaterthan1/4thoftheminimum
thicknessofthemember,providedthattheconcretecanbeplacedwithoutdifficultysoastosurroundallreinforcementthorough
e corners of the form. For reinforced concrete work, coarse aggregates having a nominal size of 20 mm. are
generallyconsideredsatisfactory. Admixture shall be used in concrete only with approval of the Engineer-in-charge
based upon theevidence that with thepassageoftime,neitherthecompressivestrength
ofconcreteisreducednorareotherrequisitequalitiesofconcreteimpaired bythe useofsuch admixtures.
Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50 kg weight. The
volume ofone such bag can be taken as 0.0342 m3. Boxes of suitable sizes shall be used for measuring sand and
aggregate. The size of theboxes (internal)shall be 30cm.x30 cm.and38 cm.deep. While measuring the aggregate
andsand,the boxshall be filledwithout shaking ramming or hammering. The proportioning of sand shall be on the
basis of its dry volume and in case of dampsand;allowancesforbulkageshallbe made.
Forallwork,concreteshallbemixedinamechanicalmixerwhichalongwithotheraccessoriesshallbekeptinfirstclass
workingcondition and maintained throughout the construction. Measured quantity ofaggregate, sand, and cement
required for eachbatch shall be poured into the drum of the mechanical mixer while it is continuously running. After
about half a minute ofdry-mixing, measured quantity of water required for each batch of concrete mix shall be added
gradually and mixing continued
foranotheroneandahalfminute.Mixingshallbecontinuedtillmaterialsareuniformlydistributedanduniformcolourofthe
entiremassisobtainedandeachindividualparticleofthecoarseaggregateshowscompletecoatingofmortarcontainingitsprop
ortionateamount of cement. In no case shall the mixingbe done for less than 2 minutes after all ingredients have
been putinto the mixer. Mixers which have been out of use for more than 30 minutes shall be thoroughly cleaned
before putting in a newbatch. Unless otherwise agreed to by the Engineer-in-charge, the first batch of concrete from
the mixture shall contain only2/3rds of normalquantityof coarse aggregate. Mixing plant shall be
thoroughlycleanedbefore changingfrom one type ofcement toanother.
Signature of Bidder Page 37 of
The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete
shall bedetermined by regular slump tests in accordance with IS: 1199-1959. The slump of 10 mm. to 25 mm. shall be
adopted whenvibratorsare used.
AllMouldsshallbecleanedandmadefreefromstandingwater,dust,snow,oriceimmediatelybeforeplacingof
concrete.Formwork/MetalMouldforexposedconcretesurface(Ifindicated):
Allthemouldsshallbecheckedforexactdimensionsoftheprecastblocks.Alltheedgesoftheprecastblocksshallconfirmthe
profile of the final drawing & edges/ curvatures of the moulds shall be checked accordingly. Moulds shall be regularly
checked forcorrectnessofdimensionsofBlocks, twists, bendsdueto handling, etc.Beforestartingevery dayswork.
Care shall be taken to set all form work/Mould in perfect line, level (or in required camber or slope as specified) and
plumb. Formwork/Mould propping shall be strong, rigid, and sturdy. The form work/Mouldshall be as per pattern &
design shown indrawings. Form work/Mould shall be done accurately and precisely so as to achieve neat, clean and
smooth concrete surface, inline, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall
not be allowed. Before placing concrete,forms shall be thoroughly cleaned off of all rust, dust, and loose materials.
Colourless oil or grease of approved quality shall
beappliedbeforeplacingsteel.Alsotheformworkmaterialwillbeofwood/plywood/steeloranysortofsuchmaterial,as
Signature of Bidder Page 38 of
approvedbytheEngineer-in-Chargeand/orhisauthorizedrepresentative;sothatallexposedconcretesurfaceshave
Forallkindofexposedconcreteworkonlyonebrand(tobeapprovedbytheEngineer-incharge)ofcementshallbeused.
RemovalofMoulds:
Specific time shall be identified for removal of moulds, such that the concrete of the precast blocks shall gain
strength towithstand the stresses generated due to self weight and handling to drying yards without any deformation
to shape/ dimensions/edges.
Sufficienttimeshallbegiventotheblockafteritisremovedfromthemouldsothatitcangainstrengthanddryinshade toprevent
anycracksdue to shrinkage. Thisshall be doneindryingyards.
Curingofblockshallbedoneonlyincuringpondandcuringshallbedoneforminimum14days.
Drying period after removing from pond & before delivery to site:Water should be drained of from the block before it
is actuallysent to the site. Time should be provided for proper draining of water which may be present in the block
kept for curingin thepond.
Precautionshallbetakenwhiletransportingoftheblocksto site.
Theblocksshouldbeloadedandunloadedwithduecaresoastoavoidgenerationofstressesleadingtobreakingofblock.Caresh
ould be taken toprevent the block from breakingduring transporting.
The pits of the size 150mm in width and required depth shall first be excavated, true to line and level. The relevant
specificationsofitem A- 1 shall be followed for excavation work. Thepits shall be filled with a layer of50mm. thick sand
bedding. The curbsthen shall be placed in position of which 50mm. shall be below road. Care should be taken to
maintain proper lineand level.Thejointsbetween thekerbsshallbepointed withC.M.1:2and
curedforminimumsevendays.
Samplingandtestingofconcrete:
Samples from fresh concrete shall be taken as per IS : 1199-1959 and cubes shall be made, curedand tested at 7 days
or 28daysas per requirements in accordance with IS : 516-1959. A random sampling procedure shall be adopted to
ensure that eachconcrete batch shall have a reasonable chance of being tested i.e. the sampling should be spread
over the entire period ofconcretingandcoverallmixing units.
Signature of Bidder Page 39 of
At least 1 sample shall be taken from each shift. Ten test specimens shall be made from each sample, 5 for testing at
7 days, andthe remaining 5 at 28 days. The samples of concrete shall be taken on each day of the concreting as per
above frequency. Thenumber of specimens may be suitably increased as deemed necessary by the Engineer-in-
charge when procedure of tests givenaboverevealsapoorqualityofconcreteand inother
specialcases.Theaveragestrength ofthe group of cubescastfor each dayshall not be less than the specified cube
strength of 200 Kg/cm2 at 28 days. 20% of the cubes cast for each day may have valueless than the specified strength
provided the lowest value is not less than 85% of the specified strength. If the concrete made inaccordance with the
proportions given for a particular grade, does not yield the specified strength, such concrete shall beclassified as
belonging to the appropriate lower grade. Concrete made in accordance with the proportions given for a
particulargrade shall not,however,be placedinahighergrade onthe ground thatthe teststrengthare higherthanthe
minimumspecified. If rock pockets/honeycombs in the opinion of Engineer-in-charge are of such an extent or
character so as to affect thestrength of the structure,materially or toendanger the life of the steel reinforcement, he
may declare the concrete defectiveand requirethe removalandreplacement oftheportionofthe structureaffected.
PrecastKerbStones:
Signature of Bidder Page 40 of
The relevant specifications of concreting as per item above shall be followed except that work shall be carried out for
precastconcrete kerb stones as specified in the item. All Precast members shall be cast at workshop. Sufficient curing
shall be donebefore placement of the samethe method of transporting and placing the precast members shall be as
approved by theEngineer-in-charge. Members shall be so transported that no breakage or undue stresses are
induced in them. If required, allmembers shall have a key provided on both the faces i.e top and bottom surfaces, of
adequate size so as to fill the same withconcrete while laying. The function of this key is to avoid the leakage through
the joint between the precast member and thememberonwhichit islaid.
ModeofMeasurementsandPayment:
Therateshallincludecostofformworkandcostofreinforcement.Thevolumeoccupiedbyreinforcementshallnot
bedeductedfromR.C.C.work.
Therateshallbeforaunitof Rmt.
Supplying and fixingof 300 mm-L x 150 mm-Bx 380 mm-H Kerb block for Footpath in M-20 grade using20 mm nominalsizeblack
trapaggregateofSevaliya/Timbaorequivalent qualityforpre-castblocks,reasonablyexposedfinish/ formwork ,mould with well
equipped with vibratory system forkerbstonesofapproveddesignincludingcuring,etc. complete, including thecost of formwork etc.
complete.The rate shall also include necessary cutting of asphalt, fixing the Kerb stones in line and level on5 cm thick sand bedding
with necessaryequipmentsandmaterials.Therateshallalso includetheflushpointinginCM
(1:3)foralljointsofthekerbstones.Fillingofzarialonethesidesofthekerbstone fixedwithBituminousconcrete mixedinproperpositionas
directed by Engineer in change to form a portable mixture.In any case Gravel or such type of materials shall not be allowed for
production. a) Laying on 5 cm thick Sand Bedding .
SpecificationasperItemNo.5onlysizeofkerbasmentionedinAbstract.
ThemodeofpaymentforthisitemshallbeonRmt.Basis.
PrecastconcretekerbProvidingandfixingM25Gradeof concreteprecastexposed/Fairfinish/texturefinishkerb
stonesofapprovedmakeasperapprovedsampleofanysizeand anytype.Kerbsshall befixedonthefoundation prepared asper
approveddesign.Therateshallalsoincludeforerectingandfixingthepiecesinpositionforcompletekerbsystemwithchamfered
typeofkerbsincludingnecessaryaccessoriesof kerb like radius kerb, angles and quadrant kerbs, droplet kerbs etc.complete
asperdrawing.Kerbshallbefixedaspaper jointwithoutanyjointingmaterial.Howevercementmortarshallbeprovided atthe backside
ofkerbstonejoint.(Samplemustbeapproved)Costofexcavation,cutting,base,side fillingshallincludesas directed engineer - incharge
in above item descriptionasperBOQ(a)450hightx600x150mm high median kerb.
Signature of Bidder Page 41 of
ThemodeofpaymentforthisitemshallbeonRmt.Basis.
PrecastconcretekerbProvidingandfixingM25Gradeof concreteprecastexposed/Fairfinish/texturefinishkerbstonesof
approvedmakeasperapprovedsample ofanysize and any type.Kerbsshallbe fixedonthe foundationpreparedasper approveddesign.
The rateshallalso includefor erectingand fixingthepiecesin positionfor completekerb system with chamfered
typeofkerbsincludingnecessaryaccessoriesof kerblikeradiuskerbs,anglesandquadrantkerbs,droplet kerbsetc.
completeasperdrawing.Kerbshallbefixedas paperjointwithoutanyjointingmaterial.Howevercement mortarshall be providedat
thebackside ofkerbstonejoint. (Sample must be approved) Cost of excavation, cutting, base , sidefillingshall
includesasdirectedengineer-inchargein above item description as per BOQ (b) 380 x 600 x 150 mm high Footpath kerb.
ThemodeofpaymentforthisitemshallbeonRmt.Basis.
Signature of Bidder Page 42 of
Providing&layingMountabletypeCentral Vergeincluding casting of Kerb of size 15.00 x 32.50 Cm by mechanical Kerb
casting machineryandoilpaintcolourtoCenterverge
(Kerb)byYellow/whiteandBlackpatta(ThreeCoat)onecoatofpriming&two coatofoilPaintincludingcostofmaterial
requiredforpaintandalllabourworketccompleteasper direction,detailed drawingandinstructionofengineer
incharge.(IncludingEpoxyPiantofApprovedQuality)
ThemodeofpaymentforthisitemshallbeonRmt.Basis.
Supplyingandfixingforcentralverge230mmLx235mmWidthx680mmHSupplying&FixinginM-20gradeusing20
mmnominalsizeblacktrapaggregateofsevaliya/timbaorequivalentqualityforpre-
castblocks,reasonablyexposedfinish/formwork,mouldwithwellequippedwithvibratorysystemforkerbstonesofapproveddesigni
ncludingcuring,etc.complete,includingthecostofformworketc.complete.THerateshallalsoincludenecessarycuttingof
asphalt,fixingthe kerb stones in line and level on 5 cm thick sand bedding with necessary equipments and materials.The rate
shallalsoincludetheflushpointinginCM(1:3)foralljointsof thekerbstones.Filling of Zarialone thesidesof thekerbstone fixed
withbituminous concrete mixed in proper position as directed by engineer in charge to form a portable mixture.In anycase
gravelor suchtypeof materials shallnotbe allowedforproduction.
Workshallbecarriedoutasperitemdescriptionincludingcostofalllabourandmaterialsetc.completeasdirected.Generalstanda
rd practice ofwork isapplicable.
ThemeasurementsshallbeonRmtbasis.
Signature of Bidder Page 43 of
Providingand Laying ofRubber Moulded Paver BlockGrey/Coloured60mmthick,M-35 Gradeofanysize; shape(UsuallyUni- Paver
Blocks) using black trap good quality aggragate of 20 mm nominal size for footpath, parking areas, service lanes andother
areas as mentioned in the drawing / instruction of Engineer-in-Charge and/or his authorized representative. Costincludes
formworks using rubber mould, Rate providing and laying paver blocks as per required grading and specification. Thepaver
block shall be mechanically compacted. The work of paving blocks shall be executed in line and level by skill mason offlooring
work only. It should be laid in such a way that the no cutting of the paver block to be necessary. if cutting of paverblock
necessary then it should be cut by machine only and carting. The finished surface of the paver block shall have resonablygood,
plain finished. Paver blocks shall be compacted and shall be relaid if necessary. Gravel or such type of materials shall notbe
allowedfor production.Layingon50mmthick sandbedding.
• Layingon50mmthicksandbedding.
Excavation and compaction up to 300 mm in height for footpath paving in all sorts of soil murrum includingsorting
outsandstackingofusefulmaterialsstuffupto 50mt.
The scope of work includes manufacturing, supplying, and lying of precast paver blocks at various Retail outlets. The
workincludes: Verification of the existing site condition and advising our project in charge to lay suitable base course
if required.Contractorsarerequiredtosatisfythemselveswithqualityofsubgrade,sub-
basecoursebeforethepaverblocksare
Signature of Bidder Page 44 of
laidandsuggeststrengtheningifrequired.
Clearing the site by removing all obstacles such as stones, debris etc. for laying of paver blocks. Manufacturing of
paver blocks inyour plant as per requirements in technical specification enclosed. Supplying of paver blocks at site,
including handling at bothends.
Laying of paver blocks at site as per requirement in technical specification on 50 mm thick sand bedding, within
shortest possibletime the site is public placehence care should be taken to ensure that theroutineactivities should
not be disturbed. The job oflayingmayrequired tobe carried outduringnightalso.
TestingofpaverblocksshallthroughreputedGovt./NonGovt.Testhouseonlyandsubmissionoftestresultsasperrequirements
Technical Specifications. AMC reserves the right to carryout test at random. Cost for such tests to be borne byparty.
The contractor shallguaranteethatallmaterialand componentsdesigned, fabricated, supplied, and
laidbyhimshallbefreefromany type of defect due to faulty material and/or workmanship/erection for a period of One
year from the date ofcompletion ofwork.However,thecontractorone year'sshallrender freemaintenance.
TECHNICALSPECIFICATIONS:
PaverBlockManufacturingFacilities:
ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:
ConcreteBlockmakingMachines:
The machine shouldbe capable of producinghighqualityPaverBlocks byobtaininghighlevelof
compactionbyapplication of hydraulic compaction and also by high intensity vibration to the moulds. The
machine should haveautomaticcontrol panel
foruniformityinstrength.
ConcreteBatching&MixingPlant:(Notessential)
TheconcreteMixDesignshouldbefollowedforeachbatchofmaterials.Theconcreteingredientshouldbemixed
inconcreteBatching&Mixingplantwithminimumcapacityof30cum/hour.Theplantshouldequippedwith
automaticcontrolpanelformaintainingwatercementratiofrombatchtobatchtoobtainconcreteofuniformquality
andstrength.Theplantshouldbeequippedwithadequatemechanismformechanizedloadingofrawmaterialsintomixer
andconveyorbeltfortransportationofconcretefrommixertoconcreteblockmakingmachinetomaintainqualityofwetc
Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.
Laboratory(Desirablebutnotessential):
Signature of Bidder Page 45 of
ThetestingequipmentshouldhaverequiredintheLaboratoryasperthe
following:ACompression testingmachineofadequate capacity.
Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.
Systematic record of test results of various paver blocks manufactured in the
factory.ConcreteMixDesignfor
variousgradeofconcreteusedformakingofpaverblocks.
SpecificationsForColouredPaverBlocks:
Colouredconcretepaverblocksshallbemanufacturedasperattachedspecificationsusingorequivalentapprovedcol
ourPigmentof“BAYER”Make“BAYFERROXIRONOXIDEPIGMENTS”withminimumcolourpigmentof3%byweightofce
ment.Thecolourshadeshallbe“RED”asselectedbyAMCbeforecommencementofthework.Whitecement
shallbeusedforcoloredpaverstoobtainthedesiredcolourshade.Thejobalsoincludesproviding50mmthicksand
beddingto matchthe shadeofthe paverblock.
Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingof
the sameatsite.
Allothertechnicalspecifications&Procedurefortesting,laying&samplingofcolouredpaverswillbeasperattachment.
PaversBlockCharacteristics:
Theconcretepaversshouldhaveperpendicularitiesafterreleasefromthemouldandthesameshouldberetained
Signature of Bidder Page 46 of
untilthe laying. The surface should be reasonably smooth and of anti skid and anti glare type. The paver
should have uniformchamfers to facilitate easy drainage surface run off. The pavers should have uniform
interlocking space of 2mm to 3mmto ensure compacted sand filling after vibration on the paver Surface. The
concrete mix design should be followed foreach batch of materials separately and automatic batching plant is
to be used to achieve uniformity in strength andquality.The pavers shall be manufactured in single layer only.
Skilled labour should be employed for laying blocks toensureline and level of laying, desired shape of the
surface and adequate compaction of thesand in the joints. Thepavers shall be of cement gray colour without
any pigment & for coloured pavers refer “specifications for
colouredpave`”Thepaversaretobeskirtedallroundwith kerbingusingsolidconcreteblocksof
size150mmX250mmX 380mm.Thekerbing shouldbeembedded for 100mm depth.The concreteused for
kerbingshall becuredproperly for 7 daysminimum.
PaverBlockDimensions:
Shape Unipaver,IshapeordirectedbyAddl.C.E.
Chamfer 4mmto6mmalongtopedges
Colour Naturalcementgreycolourwithoutuseofanypigment.
Forcolouredpaversrefer“specificationsforcolouredpavers”
DimensionalTolerance (+/-
)2mmforlength&width,(+/
)3mmforHeight(Thicknes
TestingofPaverBlocks:
SR.N *TEST AverageValues Frequency
1. CompressiveStrength Min.35N/Sqmmfor60m 250Smt/1Test
2. FlexuralStrength Minimum4.5N/Sqmm
3. AbrasionResistance Maximum1.5
4. WaterAbsorption Maximum5.80%
*Samplingandtestingprocedureasperenclosedspecifications
SamplingandTestingProcedureforPaverBlocks
Signature of Bidder Page 47 of
INTERNAL–Averageofminimum3samplesper5000Blocks.
SamplingforTesting
SamplingofPaverblocks.
Methodofsampling:
Beforelayingpaverblocks,eachdesignatedsectioncomprisingnotmorethan50000blocks,shallbedividedinto
tenapproximately equalgroups. Threeblocksshallbe drawnfrom each group.
Markingandidentification:
Allsamplesshallbeclearlymarkedatthetimeofsamplinginsuchawaythatthedesignatedsectionofpartthereof,andtheconsignm
entrepresentedbythesample,areclearlydefined.
The sample shall be dispatched to the approved test laboratory taking precaution to avoid damageto the paving
intransit. Protect the paving from damage and contamination until they have been tested. The testing shall be carried
assoon as possible, after the sample has been taken. As soon as practicable after sampling. The samples shall be
stored inwaterat20degreeC5 degreeC for24 hourspriortotesting.
The item is to be executed as per instructions and to the entire satisfaction of Engineer-in-Charge and/or his
authorizedrepresentativeusingRubbermouldandTablevibratorforKerb instead ofmechanicalpresssystem.
Extra rate for excavation of asphalt payment of anythickness including demolishing the asphalt carpet, metal, soling
etc.complete with stacking the materials as directed. The road surface of asphalt shall carefully be opened to full
width asdirected by the Engineer-in-Chargeand/or hisauthorizedrepresentative.
Signature of Bidder Page 48 of
Excavationareashallbeproperlyidentifiedandmarkedinrectangularshape.Theroadcrustshallbeopeneduptoentiredepth
i.e.including soling. All thematerials shall be separately deposited in such a way and inplaces as may bedetermined by
theEngineer-in-Charge and/or his authorized representative. In case rubble not being so deposited orbeing mixed up
with the excavated materials willnot be allowed for refilling. The cost of materials shall be charged
fromthecontractor.The decision oftheC.E.shall befinal and bindingtothecontract
For detailed specification for Laying of Paver Block on sand bedding, refer R & B Department booklet for
GeneralTechnicalSpecificationforbuilding works.
TherateshallbeforaunitofSMT
Providingandlayingofinterlockinggreypaverblocksofhighdensity80mmthickmadefromM-
40gradeconcreteusing6mmto20mmmachinecrushedwellgradedstoneaggregate,sandofapprovedquality,OPC53gradecementwith
contractor'sownconcretemixdesignasapprovedby AMC, for parking, road. Cost Includes formwork, using rubber/FRP
mould,layingpaverblockasperrequiredgradingandspecificationlaidpaverblockshallbemechanicallycompacted.Theworkof the
paving blocks shall be executed inlineandlevelbyskilledmasonofflooringworkonly.It should be laid in such away that the no
cutting of the paver block to be necessary. Cutting of paver block by machine cut only and carting to be
done.TheFinishedsurfaceofthePaverBlockshallhavereasonablygoodplainfinish.Paverblocksshallbe compactedand shallbere-
laidifnecessary.Gravelorsuchtypeofmaterialsshallnotbeallowedforproduction.Layingon5Cmsthicksandbedding.
TherateshallbeforaunitofSMT
PaverBlockProvidingandlayingshotblastedNon- interlocking,Paverblocksofspecifiedthickness, size,grade
ofconcreteandcolourmachinemadeandblastingby
automaticshotblastingmachineandhighdensityofasperapprovedsampleofapprovedmakeforfootpath,parkingareas,servicelanes,c
rossoverandotherareasasmentionedinthedrawing.Includingprovidingandlaying50mmthickaveravebeddinglayerofcoarsesandbel
owpaverblockasperrequiredgradingandspecification.Laidpaverblockshallbemechanicallycompacted.Theworkofthepavingblockss
hallbeexecutedinlineandlevelbyskilledmasonofflooringworkonly.Smallsizeofpaverblockwithsamespecificationshallbeusedatresi
dueor at end. It should be laid in such awaythat theno cutting ofthe paver blockto be necessary. If cuttingof paver block
shallberequired , than cut by machine onlyandlayingtobedonebyskilledflooringmason.The
Signature of Bidder Page 49 of
finishedsurfaceofthepaverblockshallhavecoarsesandTextureFinish.Paveblocksshallbecompactedandshallbere-
laidifnecessary.Actuallaidareashallbemeasuredand
paidwithoutanywastage.(A)60mmthickM-35gradeGrey
TherateshallbeforaunitofSMT
ProvidingandlayingshotblastedNon-
interlocking,Paverblocksofspecifiedthickness,size,gradeofconcreteandcolourmachinemadeandblastingbyautomaticshotblasti
ngmachineandhighdensityofasperapprovedsampleof
approvedmakeforfootpath,parkingareas,servicelanes,crossoverandotherareasasmentionedinthedrawing.Includingprovidingand
Signature of Bidder Page 50 of
laying 50 mm thick averave bedding layer of coarse sand below paver block as per required grading and specification.
Laidpaver block shall be mechanically compacted. The work of the paving blocks shall be executed in line and level by
skilledmason of flooring work only. Small size of paver block with same specification shall be used at residue or at end. It
should belaidinsuchawaythatthenocuttingofthepaverblocktobenecessary.Ifcuttingofpaverblockshallberequired,thancutby
machine only and layingto be done by skilled flooring mason. Thefinished surface of the paver blockshall have coarsesand
Texture Finish. Pave blocks shall be compacted and shall be re-laid if necessary. Actual laid area shall be measured andpaid
without anywastage. (A) 80mmthickM-35grade Grey Paver block ofsize200mmx200mm.
Thescopeofwork:ItincludessupplyingandlayingofPrecastshotblastedbyautomaticshotblasting
machineinfactory(noton site)paver blocksatfootpath, parking area, servicelaneand other areas.
Theworkincludes:
Paverblock shouldbelaidoverpreparedsubgrade.
Clearingthesitebyremovingallobstaclessuchasstones,debrisetc.forlayingofpaverblocks.
Manufacturingofpaverblocksbyoneoftheapprovedsuppliersasperrequirementsintechnicalspecificationenclosed.
Supplyingofpaverblocksatsite,includinghandlingatbothends.Thetypeofpaverblockmaybeinterlockingornon-
Providingandlayingaverage50mmcoarsesandbeddingforlayingblocks.
Layingofpaverblocksatsiteasperrequirementintechnicalspecification,withinshortestpossibletime.
TestingofpaverblocksthroughreputedGovt./NonGovt.Testhouseandsubmissionoftestresultsasper
inTechnicalSpecifications.Clientreservestherighttocarryouttestatrandom.Costforsuchteststobebornebycontract
The contractor shall guarantee that all material and components designed, fabricated, supplied and laid
freefromanytypeofdefectduetofaultymaterialand/orworkmanship/erectionforaperiodoffiveyearfromthedateof
comp letionofwork atindividualsites.However,thecontractorforfiveyearsshallrenderfree maintenance.
TechnicalSpecifications:
PaverBlockManufacturingFacilities:
ThePaverBlock shallbemadeinfactorywithfollowingminimumfacilities:
ConcreteBlockmakingMachines:
The machine should be capable of producing high quality Paver Blocks by obtaining high level of compaction by
application ofhydraulic compaction and also by high intensityvibration to the moulds. The machine should have
automatic control panel foruniformity instrength.
Concrete Batching & Mixing Plant: (Not essential) The concrete Mix Design should be followed for each batch of
materials. Theconcrete ingredient should be mixed in concrete Batching & Mixing plant with minimum capacity of
Signature of Bidder Page 51 of
plantshouldbeequippedwithautomaticcontrolpanelformaintainingwatercementratiofrombatchtobatchtoobtainconcre
te ofuniformqualityandstrength.
The plant should be equipped with adequate mechanism for mechanized loading of raw materials into mixer and
conveyor beltfortransportation ofconcretefrommixertoconcreteblockmakingmachineto maintainquality ofwet
Thefactoryshouldhavewelldesignedcuringareatoensureadequatecuringofpaverblocks.Steamcuringfacilityofthepaverbloc
ksispreferable.
Laboratory(Desirablebutnotessential):
Thefactoryshouldhavethefollowing:
Compressiontestingmachineofadequatecapacity.
Othertoolsandequipmentfortestingrawmaterialsandpaverblocks.
(1) Systematicrecordoftestresultsofvariouspaverblocksmanufacturedinthefactory.
(2) ConcreteMixDesignforvariousgradeofconcreteusedformakingofpaverblocks.
SpecificationsforColouredPaverBlocks:
ColourconcretepaverblocksshallbemanufacturedasperattachedspecificationsusingapprovedcolourPigmentofironoxideof
approvedbrandlikeBayer,Tataetc.withminimumcolourpigmentof3%byweightofcement.Thecolourshadeshallbe
asselected by Architect before commencement of the work. The job also includes providing 50 mm thick sand
bedding to match theshadeofthe paverblock.
Thecolourofthepaverblockshallbeguaranteedagainstfadingofcolourforperiodof12monthsfromthedateoflayingof
Allothertechnicalspecifications&Procedurefortesting,laying&samplingofColorpaverswillbeasperattachment.
Signature of Bidder Page 52 of
PaverBlockCharacteristics:
Theconcretepaversshouldhaveperpendicularitiesafterreleasefromthemouldandthesameshouldberetaineduntilthelaying.
Thesurfaceshouldbereasonablysmoothandofantiskidandantiglaretype.Thepavershouldhaveuniformchamferstofacilitate
easydrainage surfacerunoff.
Thepaversshouldhaveuniform interlockingspaceof2mmto3mmtoensurecompactedsandfillingafter
vibrationonthepaverSurface.
Theconcretemixdesignshouldbefollowedforeachbatchofmaterialsseparatelyandautomaticbatchingplantistobeusedtoachiev
eunifor mityin strengthandquality.
Thepavers shallbemanufacturedinDoublelayeronly.
Skilledlabourshouldbeemployedforlayingblockstoensurelineandleveloflaying,desiredshapeofthesurfaceandadequateco
mpaction ofthe sand inthejoints.
PaverBlockDimensions:
Doublelayered,toplayerminimum8to10
Irregular(UniformShapewithnoHollowOrCracks)/asperdrawing
Cham fer 4mmto6mmalong top edges
Colour NaturalcementgreyColour
withoutuseofanypigment.ForColourpaversrefer“spe
cifica tionsforColourpavers”
Dimensional (+/-) 2mm for length &
width,Tolerance(+/-
)3mmforHeight(Thickness)
TestingofPaverBlocks:
* Samplingandtestingprocedureasperenclosedspecifications
Sampling&TestingProceduresforPaverBlocks:
INTERNAL–Averageofminimum3samplesper 10000Blocksforcompressivestrengthandwater
absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.
SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppend
CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAp
Signature of Bidder Page 53 of
pendix- B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper
AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
FlexuralStrength:Testingfor flexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry
Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks,
shallbedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal
testing and 2 forexternaltesting.
Marking andidentification:All samplesshall beclearlymarkedat thetime of sampling insucha waythat
thedesignatedsections of part thereof, and the consignment represented by the sample, are clearly defined.The
sample shall be dispatched totheapproved test laboratory taking precaution to avoid damage to the paving in transit.
Protect the paving from damage andcontamination until they have been tested. The testing shall be carried as soon
as possible, after the sample has been taken. Assoonaspracticableaftersampling.Thesamplesshallbestored inwaterat
20degreeoCfor24hourspriorto testing.
SR.NO. *TEST SPECIFICATIONAverageValues
(AverageofMinimumFiveSamples/Site)
1. CompressiveStrength Min.30N/Sq.mmfor60mmthickandMin.40N/Sq.mm
Signature of Bidder Page 54 of
2. FlexuralStrength Minimum3.80N/Sq.mmand4.5N/Sq.mmfor60and80
mmthickpaverblockrespectively.
3. AbrasionResistance Maximum1.5
4. WaterAbsorption Maximum5.80%
5. MinimumCementContent 380Kg/CumforM30concreteand430Kg/CumforM40concrete
Sampling&TestingProceduresforPaverBlocks:
INTERNAL–Averageofminimum3samplesper 10000Blocksforcompressivestrengthandwater
absorption.EXTERNAL –Minimum 2Blocksper10000 blocksfor abrasion and flexure.
SamplingForTesting:SamplingfortestingofpaverblocksshallbedoneinaccordancewithAppend
CompressiveStrength:TestingforcompressivestrengthshallbeundertakeninaccordancewithAp
pendix- B.Theaveragecompressivestrength oftheblockstested shall be30/40 N/Sq.mmasper
AbrasionResistance:TestingforabrasionshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
FlexuralStrength:TestingforflexuralshallbeinaccordancewithIS1237(SpecificationsforCementConcreteFloorTiles).
WaterAbsorption:TestingforwaterabsorptionshallbeinaccordancewithIS2185:1979:PartI(SpecificationsforConcreteMasonry
Method of sampling: Before laying paver blocks, each designated section comprising not more than 10000 blocks,
shallbedivided into five approximately equal groups. One block shall be drawn from each group i.e. 3 for internal
testing and 2 forexternaltesting.
Markingandidentification:Allsamplesshallbeclearlymarkedatthetimeofsamplinginsuchawaythatthedesignatedsection
sofpart thereof, andtheconsignment representedbythesample, areclearlydefined.
The sample shall be dispatched to the approved test laboratory taking precaution to avoid damage to the paving
intransit.Protect the paving from damage and contamination until they have been tested. The testing shall be carried
possible,afterthesamplehasbeentaken.Assoonaspracticableaftersampling.Thesamplesshallbestoredinwaterat20degreeC
5degre eC for 24hoursprior totesting.
TestForCompressiveStrength:
TestingMachine:Thetestingmachineshallbeofsuitablecapacityforthetestandcapableofapplyingtheloadofthe
ratespecified.It shallcomply, asregardsrepeatabilityand accuracy,with therequirementsofclause2.1ofBS:1881-Part4.
Signature of Bidder Page 55 of
Procedure: The sample specimen shall be tested in a wet condition after being stored for at least 24 hours in water
maintained atatemperatureof20 C+or–5 C.Beforethespecimensaresubmergedinwater,thenecessaryareashallbedetermined.
Theplatesfortestingmachinesshallbewipedcleanandanyloosegritorothermaterialremovedfromthecontactfacesof
thespecimen. Plywood, nominally 4 mm thick shall be used as packing between the upper and lower faces of the
specimen and themachineplatesand theseboardsshallbelargerthanthespecimen by the margin ofat least5mm
atallpoints.FreshPackingshallbeusedforevery specimentested.
Thespecimenshallbeplacedinthemachinewiththewearingsurfaceinthehorizontalplaneandinsuchawaythattheaxesofthespeci
menare alignedwiththose ofthemachine plates.
Theloadshallbeappliedwithoutshockandincreasedcontinuouslyattherateofapproximately15N/Sq.mmperminuteuntilno
greaterload can be sustained.Themaximumload appliedto thespecimen shallbe recorded.
CalculationofcorrectedstrengthforindividualBlocks:Thecompressivestrengthofeachblockspecimenshallbecalculatedbydividingthemaxi
mumloadby fullcrosssection area oftheblock andmultiplyingwith anappropriatefactorof:-
a) For100mmthickblocks–1.24
b) For80mmthickblocks–1.18
c) For60mmthickblocks –1.06
CompressiveStrengthCalculation:Theaveragecorrectedcompressivestrengthforthedesignedblocksectionshallbecalculated.
4.0Methodoflaying:
Blocksshallbeplacedonthesandbeddingetc.whichwerewellrammedsoastoactasfirmbed.Blocksshallbelaidinsuchmannerthatnogapshall
beleftinbetween.Blockssolaidshallbecompactedbymeansofmechanicalcompactororequivalent
Signature of Bidder Page 56 of
compacting method so as to obtain required finished surface. All the joints shall be matched and if any
manufacturing defect
isdetectedthelotshallbereplacedandrelayingshallbedonewithoutanyextracostuptosatisfactionofEngineerincharge.
50 to 80mm thick coarse sand shall be laid as cushioning layer for arranging the paver blocks. Joints of the paver
blocks shall befilled withthe sand.
The paver blocks shall be laid properly on the prepared sub-base as per manufacturer's specification and as per
Architect andEngineer-in-charge'sinstruction.
Paver block shall be laid by the approved agency only. If manufacturer of the paver block providing the laying
services, thenitshall be laid through the supplying agency only. The labourers for paver block fixing shall be skilled
flooring mason only. Onlycutting tool shall be used for cutting the paver block. Full depth cutting toll shall be used for
proper finished surface after cutting.Manualcutting orbreaking ofthe paver block isnot permitted.
After laying of the paver block fine sand shall be spread over it and paver block shall be compacted with mechanical
compactor.Any settlement or undulationinthelaid areashallbe repaired immediately.
ModeofMeasurementand payment:
Measurementshallbedoneasperactualarealaidwithoutconsideringanywastage.
TheMeasurementoftheitem shallbeinSqmtbasis.
Labour work of fixing kurb any design of central verge, (both side) footpath kurb, items includes necessary excavation,
asphaltcutting of any thickness, erecting in line and position and pointing with cement mortar (1:3), watering, etc complete,
fillingwithzarialongthesideofthekurb,thekurbstonefixpreparedwithbitumnioustopsurface,asdirectedbyengineerincharge.
Work shall be carried out as per item description including cost of all labour and materials etc. complete as
directed.General standardpracticeof layingof paverblockis applicable.
ThemeasurementsshallbeonRMTbasis.
Signature of Bidder Page 57 of
Providingandlayingcementconcrete1:5:10(1-Cement:5-finesand:10-gradedbrickbataggregates40mmnominal size)and
curingcomplete.
Beforestartingtheconcretethebedofthefoundationstrenchesshallbeclearedofallloosematerialsandwateredand
rammedasdirected.The proportion ofcement,sand andhand brokenstone aggregatesshallbe one part ofcement,5partsof
coarsesand,10partsofhandbrokenstoneaggregatesandshallsomeasuredbyvolume.Theconcreteshallbemixedina
mechanicalmixer at thesite of work. Handmixing may however be allowedforsmaller quantity of work if approved by
theEngineer-incharge.WhenhandmixingispermittedbytheEngineer-
inchargeincaseofbreakdownofmachinery’sandintheinterestofthework.itshallbecarriedoutonawatertightplatformandcare
shallbetakentoensurethatmixingiscontinueduntilthemassisuniformincolourandconsistency.Thequantityofwater shallbe
sufficient to producea dense concrete of requiredworkability for the purpose.The concrete shallbe handled from the place of
mixing tothe final positioninnot more than 15minutes by the methodas directedand shall beplaced intoits final
position,compactedandfinishedwithin 30minutesofmixingwith water i.e. beforethesettingcommences.Theconcreteshall be laid
in layers of 15 cms. to 20 cms. The concrete shall berammed with heavy iron rammers and rapidly to get the required
compactionand to allow allthegapsto be filled with mortar.After the finalset,the concrete shallbe kept continuouslywet, if
required by pounding for a periodof notless than7 days fromthe date of placement Theconcrete shall be measuredforits length
breadth and depth, limiting dimensions to those specified onplan or asdirected.
Signature of Bidder Page 58 of
ModeofmeasurementsshallbeonCMTbasis
ProvidingTMTBarFE500DreinforcementforR.C.C.Workincludingbending,bindingandplacinginpositioncompleteuptofloortwolevel.
ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.
Modeofmeasurementsshall beonKgbasis.
ProvidingandCastinginsituordinarycementconcreteM200forR.C.C.Raftandcuttoffwallsincludingnecessaryshutteringlaying,
vibrating,ramming andcuring complete.(B)Walls, fomtopof foundationlevel uptofloortwolevel(upto10ton).
ForrelevantSpecificationofItemasperitemdescription&instructionofEngineer-in-Chargeand/orhisauthorizedrepresentative.
Modeofmeasurementsshall beonCMTbasis.
Providingandsetting50to60mm thickrougekotahstone watertable inline,leveland inrequiredgradient including25mm
thickbeddcinginC.M.1:6(1Partofcement:6Partofcoarsesand)with sufficientramming consolidation.
ProvidingjointsinC.M.1:3(1Partofcement:3Partcoarsesand)andsmoothpointinginC.M.1:1(1PartofCement,1Partofcoarsesand)incl
udingwateringetc.completeandasperdetailsintenderspecification&asdirectedbyengineer incharge.
Size:2'0"x1'0"(600mm×300mm)
Size:1'x1'(40to50mmthick)
ModeofmeasurementsshallbeonRMTbasis.
Signature of Bidder Page 59 of
LabourworkforfixinganykindofpavingwithcementpointinginCM1:2,includingwatering,rammingetccomp.asdirected
LayingonSandbeddingasperrequirementtofixtheC.C.Block/NibhadaStoneinLine&Level.
ModeofmeasurementsshallbeonSMTbasis.
ForWaterTable&KerbonSandbeddingasperrequirementtofixtheC.C.Block/NibhadaStoneinLine&Level.
ModeofmeasurementsshallbeonRMTbasis.
Signature of Bidder Page 60 of
ConstructionofRCCnosingincentralvergeusingM-
200gradecementconcrete.Theitemincludescostofcentering&shuttering,reinforcement,bothsidecementplasterinC:M1:3mortar
&curingetc.complete.Halfroundportionofthe nosing shall be made by using mild steel.
ModeofmeasurementsshallbeonNO.basis.
Providingand layingin positionReadyMixedM-200 gradeconcreteforreinforced cementconcterework,usingcementcontentasper
approved DesignMixmanufactured in fullyautomaticbatchingplant and transportedtositeofworkintransit mixer foralead up to
10 kms having continuous agitated mixer, manufactured as per mix design of specified grade for reinforced
cementconcreteworkincludingpumpingofR.M.C.fromtransitmixertositeoflaying,excludingthecostofcenteringshutteringfinishinga
nd reinforcement including cost of admixtures in recommended proportions as per IS:9103 to accelerate/ retard setting
ofconcrete, improve work ability without impairing strength and durability as per direction of theEngineer-in-charge. Without
FlyAsh (Min cement level asper latest IS456 shall be maintained) (Cement level 400 kg )
ModeofmeasurementsshallbeonCMT.basis.
Provdg.Formworkofordinarytimberplankingsoastogivearoughfinishincl.centering,shuttering,struttingandproppingetc.heightofpr
oppingandcenteringbelowsupportingfloortoceilingnotexceeding4M&removalofthesameforinsitureinforcedconcrete and plain
concrete work in
ModeofmeasurementsshallbeonSMT.basis.
P/A Trimix with dewatering machine and floater machine on constructed RCCwork incl.cost of machine and labouretc comp
ModeofmeasurementsshallbeonSMT.basis.
Signature of Bidder Page 61 of
Making 15 mm groove in RCC work on road and filling it with polysulfied selant and finished it good incl.all labour charges
etccomp as directed.
ModeofmeasurementsshallbeonRMT.basis.
Hiringoftractorwithtrolleyconsidering8Hrs.asworkingdayhoursincl.Driver
ModeofmeasurementsshallbeonDAY.basis.
Providingchotahathiordriver with fuel,to carryout different works duringday/nightfor 8hrs. shift.Workshallbe carriedoutas
pertheinstructionsofEngineer in charge 4Nos of labour allnecessarypermit etc. comp.(For 8 hoursshift )
ModeofmeasurementsshallbeonSHIFT.basis.
Signature of Bidder Page 62 of
Providing & Supplying JCB Machine on rental basis in case of emergency situation and break down type work & also
duringunavoidableconditionasperinstructionofengg.incharge,rateincludesallnece.shifting,fuelandoperatingchargesandstackingo
fuseful&non-usefulmaterialsseparatelyuptostore.(Nopaymentshouldbeallowedfornonworkingconditionofmachineryand for
pipe line excavation and layingwork) (Based on Previously approved rate by CE sir )
ModeofmeasurementsshallbeonHOUR.basis.
Supplying Pneumatic Breaker Machine for RCC Slab or Asphalt Demolishing Work on site by using Operator, fuel, power
Supplyetc. Complete asDirected. (No payment should be allowed for non working condition of machinery and forpipe line
excavationand M.H.work. Allowed onlyfor break down work) (Based on Previously approvedrateby C Esir )
ModeofmeasurementsshallbeonHOUR.basis.
Repairingdamaged M.H.andrasingM.H.upto roadlevelincl.removingdamagedbrickworkandrepairing bybrick masonryin
C.M. 1:5and plaster in C.M.1:3 and fixingC.I.stepsand existingMHsheetcover,removingthedebris fromMHand cartingthesame as
ModeofmeasurementsshallbeonNOS.basis.
Repairing damaged I.C./Raisingremoving damaged brick work and repairing by brick masonry in C.M. 1:5 and plaster in C.M.1:3
and fixingC.I. stepsand existingchamber sheet cover, removingthedebrisfrom chamberand cartingthe sameasdirected.
ModeofmeasurementsshallbeonNOS.basis.
Signature of Bidder Page 63 of
ProvidingF.R.C.MHseatcoverincl.cartingtotheworksiteetc.comp.Directed.
A. F.R.C.ExtraHeavyDuty(EHD-35)ManholeCovers& Frames Cover : 728mm ø & 100 mm thick circular cover, 35.00 MTload
design, 100x2mm MS flat allround, 16mm ø plain round bar for lifting the cover & should be fitted with plastic cups.Frame :
560 mm ø clear opening, outer size- 888x888x175 mm. On the upper periphery of frame 25 x 3 mm wide MS flatshould be
wellembed in concreteto protectthe edges offrame.FRC E.H.D.-35manholecover & framedescribedasabove
B. F.R.C. Heavy Duty [HD-20] Machinehole Covers - 560 mm ø clear opening, The dimension of frame and cover as
permentioned in Amend No.1 to IS 12592 : 2002 table
C. F.R.C. Medium Duty [MD-10] Machinehole Covers - 560mm ø clear opening, The dimension of frame and cover as
permentioned in Amend No.1 to IS 12592 : 2002 table 1..
D. F.R.C. Medium Duty [MD-10] Chamber Covers & Frame- 600 x 450 mm clear opening, The dimension of frame and cover
asper mentioned in Amend No.1 to IS 12592 : 2002 table
E. F.R.C. Light Duty [LD-2.5] Machinehole Covers & Frames-560mm ø clear opening, The dimension of frame and cover as
permentioned in Amend No.1 to IS 12592 : 2002 table
ModeofmeasurementsshallbeonNOS.basis.
Carting and Fixing M.H., Chamber or Catchpite Seat and Cover in line and level to match exisisting road level in C.C. 1:2:4
andfinishing smooth, watering and protecting for 7 days etc. complete as directed. M.H. seat cover will be supplied
byA.M.C.(fromanystore)
ModeofmeasurementsshallbeonNOS.basis.
Signature of Bidder Page 64 of
Supplying, labour for breakdown repairing work for activities like excavation, disliting, removing debris from trench back
fillingetc. comp. as directed by Eng.in charge.
ModeofmeasurementsshallbeonNOS.basis.
Constructing Bombay Pattern Type Catch Pit of size 0.60 x 0.60 depth up to 1 mt including excavation, B.B.C.C. (1:5:10),
cmsthickbrickmaso.wallin theprop.ofCM(1:6)with 40mmthickIPSflooringinthepropM15atbottomand15mmthickcementplaster
inside the catch pit in the proportion of CM (1:3) with out jali etc.comp. asdirected.
ModeofmeasurementsshallbeonNOS.basis.
CatchPitJali(Heavyduty)FixingP/FFRCcatchpitjaliwithframe600mmx600mmclearopeningetc.comp..Asdirectedbyengineer in
ModeofmeasurementsshallbeonNOS.basis.
Providing, laying, spreading and compacting graded stone aggregate to wet mix macadam specification including premixing
theMaterialwith water atOMC in mechanicalmixplant carriageofmixedMaterialbytipper to site,layingin uniform layers in sub-
base / base course on well prepared surface and compacting with vibratory roller to achieve the desired density as per
CodalProvision.
Production&SupplyofWMMtositeof
worksLayingof WMM
Signature of Bidder Page 65 of
This work shall consist of laying and compacting clean, crushed, graded aggregate and granular material, premixed
with water, toa dense mass on a prepared sub-grade/sub- base/ base or existing pavement as the case may be in
accordance with therequirements of these Specifications. The material shall be laid in one or more layers as
necessary to lines, grades and cross- sectionsshownon the approved drawingsorasdirected bytheEngineer.
The thickness of a single compacted Wet Mix Macadam layer shall not be less than 75 mm. When vibrating or other
approvedtypesof compacting equipment areused, the compacteddepth ofa singlelayerofthesub-basecoursemay
beupto200 mmwith the approval ofthe Engineer.
PhysicalRequirements
Coarseaggregatesshallbecrushedstone.TheaggregatesshallconformtothephysicalrequirementssetforthinTable19-1.
Sevaliya/Timba/Ankodiyaspecialaggregateisonlyacceptable.
Ifthewaterabsorptionvalueofthecoarseaggregateisgreaterthan2percent,thesoundnesstestshallbecarriedoutonthemateri
aldeliveredto site asperIS:2386 (Part-5).
Table19-1:PhysicalRequirementsofCoarseAggregatesforWetMixMacadamforSub-base/BaseCourses
S.No. Test TestMethod Requirements
1. LosAngelesAbrasionvalu IS:2386(Part-4) 40percent(Max.)
eorA ggregateImpact
value IS:2386(Part- 30percent(Max.)
2. CombinedFlakinessandElongationindice IS:2386(Part-1) 35percent(Max.)*
* Todetermine thiscombinedproportion,the flakystonefromarepresentativesample shouldfirstbeseparatedout.Flakinessindexis weightofflakystonemetal
divided by weight of stone sample. Only the elongated particles be separated out from the remaining (non-flaky) stone metal. Elongation
indexisweightofelongatedparticlesdividedbytotalnon-flakyparticles.Thevaluesofflakinessindexandelongationindexsofoundareaddedup
GradingRequirements
TheaggregatesshallconformtothegradinggiveninTable19-2.
Table19-2:GradingRequirementsofAggregatesforWetMixMacadam
ISSieveDesignation PercentbyweightpassingtheISSieve
Signature of Bidder Page 66 of
Materialfinerthan425micronshallhavePlasticityIndex(PI)notexceeding6.
The final gradation approved within these limits shall be graded from coarse to fine and shall not vary from the low
limit on onesievetothehighlimit ontheadjacentsieve orviceversa.
ConstructionOperations:-
Preparation ofBase
The surface of the sub-grade/sub-base/base toreceive the Wetmixmacadam courseshall be preparedtothe
specifiedgradeand camberandcleaned ofdust, dirtand other extraneous material. Any rutsor
softyieldingplacesshallbecorrectedin anapproved manner and rolleduntil firmsurface isobtained.
Where the Wet mix macadam is to be laid on an existing metalled road, damaged area including depressions and
potholesshallbe repaired and made good with the suitable material. The existing surface shall be scarified and re-
shaped to the required gradeand camberbeforespreadingthe coarseaggregate forWetmixmacadam.
PreparationofMix
WetMixMacadamshouldbepreparedinanapprovedmixingplantofsuitablecapacityhavingprovisionforcontrolledaddition
of water and forced/positive mixing arrangement like pugmill or pan type mixer of concrete batching plant.For small
quantity ofwet mixwork,theEngineermay permitthemixingtobedone in concrete mixers.
QuantityofwatershouldnotvaryfromOMCdeterminedas perIS: 2720 (partVIII)bymorethanagreedlimit.The
mixedmaterialshould be uniformly wetand nosegregation should be permitted.
Immediately after mixing, the aggregates shall be spread uniformly and evenly upon the prepared subgrade/sub-
base/base inrequired quantities. In no case should these be dumped in heaps directly on the area where these are to
be laid nor shall theirhaulingover a partlycompleted stretchbe permitted.
The mix may be spread either by a paver finisher or motor grader or as per instruction of Engineer-in-Charge and/or
hisauthorized representative. For portions where mechanical means cannot be used, manual means as approved by
the Engineershall be used.The motor grader shall be capable of spreading the material uniformly all over the surface.
Signature of Bidder Page 67 of
Its blade shall havehydrauliccontrolsuitableforinitialadjustmentsandmaintainingthesame soasto
achievethespecifiedslopeand grade.
Signature of Bidder Page 68 of
Thepaverfinishershallbeself-propelled,havingthefollowingfeatures:
(i) Loadinghoppersandsuitabledistributionmechanism
screedshallhavetampingandvibratingarrangementforinitialcompactiontothelayerasitisspreadwithoutruttingorotherwisemarringthe
surface profile.
(iii) Thepavershallbeequippedwithnecessarycontrolmechanismsoastoensurethatthefinishedsurfaceisfreefromsurfaceblemishes.
The surface of the aggregate shall be carefullycheckedwithtemplates andall high or low sports remediedbyremoving
oradding aggregate as may be required. The layer may be tested by depth blocks during construction. No segregation
andfineparticlesshouldbeallowed.Theaggregatesasspreadshouldbeofuniformgradationwithnopocketsoffinematerials.
Afterthemixhasbeenlaidtotherequiredthickness,gradeandcrossfall/camberthesameshallbeuniformlycompacted,tothefullde
pthwithsuitableroller.Ifthethicknessofsinglecompactedlayerdoesnotexceed100mm,smoothwheelrollerof80to
100kNweightmaybeused.Foracompactedsinglelayerupto200mm,thecompactionshallbedonewiththehelpof
vibratoryrollerofminimum
staticweightof80to100kNorequivalentcapacityroller.Thespeedoftherollershallnotexceed5km/h.
In portions having unidirectional cross fall/superelevation, rolling shall commence from the lower edge and progress
graduallytowardstheupperedge.Thereafter,rollershouldprogressparalleltothecentrelineoftheroad,uniformlyover-
lapping eachpreceding trackbyatleastone thirdwidthuntil theentire surfacehas beenrolled.Alternate trips of the
rollershallbeterminated instopsatleast 1m away from any preceding stop.
In portions in camber, rolling should begin at the edge with the roller running forward and backward until the edges
have beenfirmly compacted. The roller shall then progress gradually towards the centre parallel to the centre line of
the road uniformlyoverlappingeach oftheprecedingtrack by at least one-third width untiltheentiresurfacehasbeen
Any displacement occurring as a result of reversing of the direction of a roller or from any other cause shall be
corrected at onceasspecifiedand/or removedandmade good.
Along forms, kerbs, walls or other places not accessible to the roller, the mixture shall be thoroughly compacted with
mechanicaltampersora plate compactor.Skin patching ofanarea without scarifyingthesurfaceto
permitproperbondingofthe addedmaterialshall notbepermitted.
Rollingshouldnotbedonewhenthesubgradeissoftoryieldingorwhenitcausesawave-likemotioninthesub-
base/basecourse or subgrade. If irregularities develop during rolling which exceed 12mm when tested with a 3 metre
straightedge, thesurfaceshouldbeloosened and premixed materialadded orremovedasrequired beforerolling again so
uniformsurfaceconformingtothedesiredgradeandcrossfall.Innocaseshouldtheuseofunmixedmaterialbepermittedtomake
Signature of Bidder Page 69 of
depressions.Rollingshallbecontinuedtillthedensityachievedisatleast98percentofthemaximumdrydensityforthematerial
asdetermined by the method outlinedin IS :2720(Part-8).
Aftercompletion,thesurfaceofanyfinishedlayershallbewell-
closed,freefrommovementundercompactionequipmentoranycompactionplanes, ridges, cracks and loose material. All
loose, segregated or otherwise defective areas shall be made goodtothe fullthicknessofthelayer andrecompacted.
Settinganddrying:
Afterfinalcompactionofwetmixmacadamcourse,theroadshallbeallowedtodryfor24hours.
OpeningtoTraffic
Preferablynovehiculartrafficofanykindshouldbeallowedonthefinishedwetmixmacadamsurfacetillithasdriedand
thewearingcourse laid.
SurfaceFinishandQualityControlof
WorkSurface evenness:
ThesurfacefinishofconstructionshallconformtotherequirementsofClauseinItemNo.16&17&18.
Qualitycontrol:
ControlonthequalityofmaterialsandworksshallbeexercisedbytheEngineerasperTable19-3.
Table19-3:TestandFrequencyforMaterialsforWetMixMacadam
Signature of Bidder Page 70 of
Test Frequency ISCode
ofConstru (AsperCircularNo.66)
Wet Gradation Onetestper200Cu.m. IS:2386,Part-I-1963
MixMacad AggregateImpactValue Onetestper1000Cu.m. IS:2386,Part-IV
Combined Flakiness Onetestper500Cu.m. IS:2386,Part-I
andElongationIndices
AtterbergLimitsofportion Onetestper200Cu.m. IS:2720,Part-V
ofaggregatespassing
Onesetofthreetests
Densityofcompactedlayer IS:2720,Part-VIII
RectificationofSurfaceIrregularity
Where the surface irregularity of the wet mix macadam course exceeds the permissible tolerances or where the
course isotherwise defective due to subgrade soil getting mixed with the aggregates, the full thickness of the layer
shall be scarified overthe affected area, reshaped with added premixed material or removed and replaced with fresh
premixed material as applicableand recompacted. The area treated in the aforesaid manner shall not be less than
m long and 2 m wide. In no case shalldepressionsbefilledup withunmixed andungraded materialor fines.
ArrangementforTraffic
Duringtheperiodofconstruction,arrangementsforthetrafficshallbeprovided.TheContractorshalltakeallnecessarymeasu
res for the safety of traffic during construction and provide, erect and maintain such barricades, including signs,
marking,flags, lightsand flagmenasper instruction oftheEngineer-in-charge.
MeasurementsforPayment
Therateshallbeforaunitofonecubicmeter. Item
Dismantlingthefollowingincludingloading,unloadinganddisposalofunserviceablematerialforallleadorasdirectedby
Engineer-In-Chargeandstackingtheserviceablematerialandbackfillingtheresultingtrenchesandpitscomplete. (Based
on Previously approved rate by CE sir )
A. centralverge-kerbstone
B. Dismantlingtiledorstonefloorslaidinmortarincludingstackingofserviceablematerialanddisposalofuservicalble material with
all lead and lifts
Signature of Bidder Page 71 of
TherateshallbeforaunitofRMT/SMTBASIS. Item
Applyingprimingcoatovernewsteelandanyothersurfaceafterandincludingpreparingthesurfacebythroughlycleaning,
oil,grease, dirt and other foreign matter and scoured with brushes fine steel wood, scrapers and sand paper with ready mixed
priming paint brushing red lead.
TherateshallbeforaunitofSMTBASIS.
Signature of Bidder Page 72 of
Painting one coats(excluding promingcoat) on previously painted steeland other metalsurface with enamel paint, brushingto give
an even shade including cleaning the surface of all dirt, duct and other foreign matter.
TherateshallbeforaunitofSMTBASIS.
Labourworkforfixinginterlockingblocks/anykindofpavementonupto50mmthsandbedding,levelling,wateringand fixing in line &
level as well cleaning the site etc.comp. as directed.
TherateshallbeforaunitofSMTBASIS.
ReinstatementworkforCentralvergeandfootpathKerbStone
TherateshallbeforaunitofRMTBASIS.
PaintingTwoCoatsondividerandfootpathcurbsurface/NewConcreteSurface(Paintingtwocoatsafterfillingthesurfacewith synthetic
enamel paint in all shades on new plastered concrete surfaces)
TherateshallbeforaunitofSMTBASIS.
ThecolourandworkmanshipshallbeinaccordancewiththeCodeofPracticeforpainting,andasspecifiedinthedrawingsorasdirecte
d bytheEngineer
Signature of Bidder Page 73 of
Materials:SyntheticenamelpaintshallconformtoIS.
Thematerialsrequiredforworkofpaintingworkshallbeobtaineddirectlyfromapprovedmanufacturersorapproved dealer
andbrought tothesite in maker'sdrums, kegsetc.withseal unbroken.
All materials not in actual use shall be kept properly protected, lids of containers shall be kept closed and surface of
paint in openor partially open containers covered with a thin layer of turpentine to prevent formation of skin. The
materials which havebecome stale or flat due to improper and long storage shall not be used. The paint shall be
stirred thoroughly in its
containerbeforepouringintosmallcontainers.Whileapplyingalsothepaintshallbecontinuouslystirredinsmallercontainer.
No left overpaint shallbeput back intostocktins.When not in use, thecontainersshallbekept properly closed.
Ifforanyseasons,thinningisnecessary,thebrandofthinnerrecommendedbythemanufacturershallbeused.
The surface to be painted shall be thoroughly cleaned and dusted. All rust, dirt and grease shall be thoroughly
removed beforepainting is started. No painting on exterior or other exposed parts of the work shall be carried out in
wet, damp of otherwiseunfavorableweatherand all thesurfacesshallbe thoroughly dry beforepainting work isstarted.
Signature of Bidder Page 74 of
Brushing operations are to be adjusted to the spreading capacity advised by the manufacture of particular paint. The
paint shallbeapplied evenly and smoothly bymeansof crossing and layingoff. The crossingandlaying off
consistsofcovering thearea overwith paint, brushing the surface hard for the first time over and then brushing
alternately in opposite directions two or threetimesand thenfinally brushing lightly in directionat rightanglesto the
In this process, no brushmarks shallbe left afterthe laying off isfinished. The fullprocess of crossing and
layingoffwillconstituteone coat.
Each coat shall be allowed to dry completely and lightly rubbed with very fine grade of sand paper and loose particles
brushed offbefore next coat is applied. Each coat shall vary slightly in shade and shall be got approved from Engineer-
in-charge before nextcoat isstarted.
Each coat except the last cost shall be lightly rubbed down with sand-paper of fine pumice stone and cleaned of dust
before thenext coat is applied. No hair marks from the brush or clogging of paint puddles in the corners of panels
angles of mouldings etc.shallbe lefton the work.
Approvedbestqualitybrushesshallbeused.
Modeofmeasurements&payment:
Signature of Bidder Page 75 of
Ahmedabad Municipal Corporation
AnytypeofC.C.Centralvergescurbssurfaceshallbemeasuredunderthisitem.
Alltheworkshallbemeasurednotinthedecimalsystemasexecutedsubjecttothefollowinglimitsunlessot
herwisestatedhereinafter:
(a) dimensionsshallbemeasuredtothenearest0.01metre.
(b) Areasshallbeworkedouttothenearest0.01Sq.metre.
Nodeductionsshallbemadeforopeningsnotexceeding0.5sq.mt.eachandnoadditionshal
lbemadeforpainting tobeadings,mouldings, edges,jambs, soffits,etc. ofsuchopening.
Thedifferentsurfacesshallbegroupedintoonegeneralitem,areasofunevensurfacebeingconvert
edintoequivalentplain areasinaccordancewiththemode ofmeasurementforpayment.
Therateshallbefor aunitofoneSMT.
Providing and fixing Swiss type Bollard made out of 1.5mm CRC sheet, height 140 cms, bottom dia
23cm, top dia 12cm with direction plate of 30 cm dia fabricated necessary anchors as directed and
also provide through out lengh pipe of 25 NB for the strenthing of bollard and reflectorised Micro
Prismatic Grade Sheet (Type-XI) and three yellow strip 6 Inches wide of Type-XI Retro reflective
Sheeting, fixing with P.C.C M-25 grade concrete (Foundation size 30cm×30cm×35cm).
The rate shall be for a unit of Nos.BASIS.
Supplying And Fixing Jumbo Bollard Swiss Type Made out of 1.5 cm crc sheet height
cms. Bottom dia 30 cms. Top dia 18cm. With direction plate of 45cm dia. Fabricated as
per attached drawing, pre treated with phospheting process painted with apoxy coating
reflectorised with retro reflective sheetings specified by M.O.R.T & H.'s latest specification.(B)
High Intensity Grade..
The rate shall be for a unit of Nos.BASIS
IHAVEALSOGONETHROUGHTECHNICALSPECIFICATIONSFORTHEITEMS(ASPERSTANDARDP.W.D.TEC
HNICAL SPECIFICATION FOR THE ITEMS AND ALSO I HAVE THE BOOK OF THE SAME) AND AGREE TO
INCASE OF WHERE IS NO TECHNICAL SPECIFICATIONFOR THE ANY ITEMS
AVAILABLE,SPECIFICATION GIVENBY THEENGINEER-IN-CHARGE SHALL BE FOLLOWED AND FOR
THE SAME I AGREE TO ABIDE BY THEM.
Seal and Signature of the Bidder Add City Engineer
Date: Ahmedabad Municipal Corporation
Signature of Bidder Page 1 of
Ahmedabad Municipal Corporation
yb>tJt> BGþrlrmrvj ftuvtuohuNl
bægÍtul- Esluh Ftðþ
vtKe, z[ulus, vuJ´d, heEMxuxbuLxlt ftuLx[tfxhu Ftm JtkaJt ylu ægtlbtk htFJtle ctc< leau Bþsc Au.
"yt ftblt >huf ytExblt sÚ&tbtk ~ËLg &e cMmtu xftle JD^x &Jt mkCJ Au. ftuE
ytExbltu CtJ J^thtu ytvJtbtk ytJNu lrn. yuf s ftuLx[tfxhu yuf søgtyu <btb ftbdehe vtKe,
z[ulus, vuJ´d, heEMxuxbuLx rJ. <btb ftbdehe fhJtle Au. yBþf JF<u btºt vtKelt Ôgrf<d< flufNltu
s c>jJtlt «mkdtu WCt &Nu ylu yBþf JF< btºt bulntuj/ auBchlu Vh<u fta ltkFuÕþk ÃjtMxh fhJtLþk
&tg <uÔþk vK clNu. yBþf søgtyu swlt vÚ&h s VheJth heEMxux fhJtlt &Nu fu btºt ytMVtÕx htuz
d{tWxed - heEMxux fhJtltu &Nu. <uJe >huf ytExbbtk J^^x &tg fu ytExb yufÍefGþx l &tg <uÔþk vK
clNu. ytlt btxu ftuEvK «fthle J¤<hle btkdKe fhJtle hnuNu lrn fu CtJ J^thtu, vK ytvJtltu
&Nu lrn. <ult btxu Ãþh<tk mt^ltu ylu bsqhtu ntug, yuf mt&u yluf søgtytuyu ftb fhJtle ûtb<t ntug
<ubKu s rJathelu xuLzh ChÔþk. bsqhtu l&e fu dtbzu s<t hÌtt Au fu ntu¤e, lJhtºte, r>Jt¤e, jøl meÍl
fu yLg <nuJthtubkt fu «mkdtubtk bsqhtu ytJ<t l&e <uJt fu ceò ftuEvK cntlt nuX¤ ftb ck^ htFe
NftNu lrn. yLg&t yuLSlegh RLatso le Nwalt bwsc ftblt s&t «btKu htusle vulÕxe ftb ck^
hnu fu MËalt fh<t ytuAt bsqhtu ytJu <ulu je^u fhJtbtk ytJNu."
ftuLx[tfxhle mne yuzeu.mexe.yuLSlegh
rm¬t ylu btuctEj lkch (bægÍtul)
Signature of Bidder Page 2 of
Ahmedabad Municipal Corporation
AHMEDABAD MUNICIPAL CORPORATION
ENGINEERING DEPARTMENT (CENTRAL ZONE)
BILL OF QUANTITY
Sr. No. Item Description Qty Rate per Amount
Excavation for foundation upto 1.5 mt.
depth including sorting out stacking of useful
material & disposing of excavated stuff upto
50 mt. lead loose or soft soil.
Dismantling the following including
loading, unloading and disposal of
unserviceable material for all lead or as
2 directed by Engineer-In-Charge and
stacking the serviceable material and
backfilling the resulting trenches and
a central verge -kerb stone 1000 8 Rmt
Dismantling tiled or stone floors laid in
mortar including stacking of serviceable
material and disposal of uservicalble
material with all lead and lifts.
Demolition & disposal of unservisable
c material with all lead and lift for 200 348.1 Cmt
unreinforeced concrete. (AMC sor)
Demolition of brick work & stone
masonry including stacking of serviceable
d materials and disposal of unserviceable 200 314.5 Cmt
materials with all lead and lift (1) In cement
Demolition including stacking of
serviceable materials and disposal of
unserviceable materials with all lead and lift.
(I) R.C.C work.
Labour Work For Fixing Any Kind Of
Paving With Cement Pointing In Cm 1:2,
Including Watering, Ramming Etc Comp. As
Dir.For Pavement Sub:-
(A)For Water Table & Kerb On Sand Bedding
(a) As Per Requirement To Fix The C.C.Block / 1000 30.8 Rmt
Nibhada Stone In Line & Level
(A)Labour work for fixing Interlocking Blocks /
any kind of pavement on up to 50 mm th sand
(b) bedding, levelling, watering and fixing in line 10,000.00 68.64 Smt
& level as well cleaning the site etc.comp. as
Signature of Bidder Page 3 of
Ahmedabad Municipal Corporation
Providing, laying, spreading and compacting
graded stone aggregate to wet mix macadam
specification including premixing the Material
with water at OMC in mechanical mix plant
4 carriage of mixed Material by tipper to site,
laying in uniform layers in sub- base / base
course on well prepared surface and
compacting with vibratory roller to achieve
the desired density as per MoRTH clause
(A) Supply of WMM 1600 1708.13 Cmt
(B) Laying of WMM 2000 31.25 Cmt
Conveyance charge of earth, lime,
murrum, building rubbish,
manure, garbage, sludge, excavated
rock, fly ash, aggregates of any kind
executed outside the road site. Rate also
5 includes spreading & levelling etc
complete. Internal conveyance above
mt done within the work site is not payable.
(R&B 2021-22 Statement No.5 Page no.5
& RA Approved St.Com.Res
d d) Lead From 3 Km to 4 Km. 700 45.52 Cmt
e e) Lead From 4 Km to 5 Km. 3000 52.42 Cmt
Leveling Or Orientation Of Existing Gully
Trap Chamber Incl. Nece. Masonry In
Cm 1:6 And Plaster In Cm 1:3 Etc. Using
Old G.T.Stone And Cover Etc. Comp.Sub:-
Repairing damaged M.H. and rasing M.H.
up to road level incl. removing damaged brick
work and repairing by brick masonry in C.M.
7 1:5 and plaster in C.M. 1:3 and fixing C.I.
steps and existing MH sheet cover,
removing the debris from MH and
carting the same as directed.
(A) Up to 0.15 mt. (@ Two Coarse) 200 728.82 No
(b) up to 0.35mt. (@ Four Coarse) 200 1,155.44 No
(C ) up to 0.65 mt. (@ Seven Coarse) 200 1,786.49 No
Extra Rate Over Item Of Excavation Of
Earth For Excavation Of Asphalt Pavement /
Rcc Of Thickness Upto 0.20 Meter Including
8 Demolishing The Asphalt Carpet, Metal,
Soiling/Cutting Reinforcement Etc.Comp.
With Stacking The Material As Directed.
(a) A) Upto 0.20 Meter Thickness (By Manual) 1000 70.4 Smt
B) 0.20 Meter To 0.30 Meter Thickness (By
Breaker Machine Including Cost Of
Operator, Fuel, & Transportaion Etc
Signature of Bidder Page 4 of
Ahmedabad Municipal Corporation
(C) 0.30 Meter & Above (By Breaker
(C ) Machine Including Cost Of Operator, Fuel, & 1000 311.08 Smt
Transportaion Etc Complete.
Supplying and fixing of 380 mm H x
mm L x 200 mm B Kerb block for Central
Verge in M-20 grade using 20 mm
nominal size black trap aggregate of
Sevaliya/Timba or equivalent quality for
pre-cast blocks, reasonably exposed
finish/ formwork, mould with well
equipped with vibratory system for kerb
stones of approved design including
curing, etc. complete, including the cost of
formwork etc. complete. The rate shall also
include necessary cutting of asphalt, fixing the
Kerb stones in line and level on 5 cm
thick sand bedding with necessary
equipments and materials. The rate shall also
include the flush pointing in CM (1:3) for all
joints of the kerbstones. Filling of zari alone
the sides of the kerb stone fixed with
Bituminous concrete mixed in proper
position as directed by Engineer in change to
form a portable mixture. In any case
Gravel or such type of materials shall
not be allowed for productiona) Laying on
cm thick Sand Bedding
Supplying and fixing of 300 mm-L x
mm-B x 380 mm-H Kerb block for Footpath
in M-20 grade using 20 mm nominal size black
trap aggregate of Sevaliya/Timba or
equivalent quality for pre-cast blocks,
reasonably exposed finish/ formwork
mould with well equipped with vibratory
system for kerb stones of approved
design including curing, etc. complete,
including the cost of formwork etc.
complete. The rate shall also include
necessary cutting of asphalt, fixing the
Kerb stones in line and level on 5 cm
thick sand bedding with necessary
equipments and materials. The rate shall also
include the flush pointing in CM (1:3) for all
joints of the kerbstones. Filling of zari alone
the sides of the kerb stone fixed with
Bituminous concrete mixed in proper
position as directed by Engineer in change to
form a portable mixture. In any case
Gravel or such type of materials shall
not be allowed for production. a) Laying on
5 cm thick Sand Bedding
Signature of Bidder Page 5 of
Ahmedabad Municipal Corporation
Pre cast concrete kerb Providing and fixing
M25 Grade of concrete precast exposed /
Fair finish / texture finish kerb stones of
approved make as per approved sample of
any size and any type. Kerbs shall be fixed
on the foundation prepared as per
approved design. The rate shall also
include for erecting and fixing the pieces
in position for complete kerb system
with chamfered type of kerbs including
11 necessary accessories of kerb like radius 200 1,061.61 Rmt
kerb, angles and quadrant kerbs, droplet
kerbs etc. complete as per drawing. Kerb
shall be fixed as paper joint without any
jointing material. However cement mortar
shall be provided at the backside of kerb
stone joint. (Sample must be approved)
Cost of excavation, cutting , base , side filling
shall includes as directed engineer - incharge
in above item description as per BOQ (a)
hight x 600x 150 mm high median kerb.
Pre cast concrete kerb Providing and fixing
M25 Grade of concrete precast exposed /
Fair finish / texture finish kerb stones of
approved make as per approved sample of
any size and any type. Kerbs shall be fixed
on the foundation prepared as per
approved design. The rate shall also
include for erecting and fixing the pieces
in position for complete kerb system
with chamfered type of kerbs including
12 necessary accessories of kerb like radius 1000 912.5 Rmt
kerbs, angles and quadrant kerbs, droplet
kerbs etc. complete as per drawing. Kerb
shall be fixed as paper joint without any
jointing material. However cement mortar
shall be provided at the backside of kerb
stone joint. (Sample must be approved)
Cost of excavation, cutting , base , side filling
shall includes as directed engineer - incharge
in above item description as per BOQ (b)
x 600 x 150 mm high Footpath kerb.
Providing & laying Mountable type Central
Verge including casting of Kerb of size 15.00 x
32.50 Cm by mechanical Kerb casting
machinery and oil paint colour to
Center verge (Kerb) by Yellow/white
and Black patta (Three Coat) one coat of
priming & two coat of oil Paint including
cost of material required for paint
and all labourworketc complete as per
direction, detailed drawing and instruction
of engineer incharge.(Including Epoxy
Piant of Approved Quality) (Central
Signature of Bidder Page 6 of
Ahmedabad Municipal Corporation
Supplying and fixing for central verge 230 mm
L x 235 mm Width x 680 mm H Supplying &
Fixing in M-20 grade using 20 mm nominal
size black trap aggregate of sevaliya/timba
or equivalent quality for pre-cast
blocks,reasonably exposed
finish/formwork,mould with well equipped
with vibratory system for kerb stones of
approved design including
curing,etc.complete,including the cost of
formwork etc.complete.THe rate shall also
14 include necessary cutting of asphalt,fixing the 100 1,376.75 Rmt
kerb stones in line and level on 5 cm thick
sand bedding with necessary equipments and
materials.The rate shall also include the
flush pointing in CM(1:3)for all joints of the
kerbstones.Filling of Zari alone the sides of
the kerb stone fixed with bituminous
concrete mixed in proper position as
directed by engineer in charge to form a
portable mixture.In any case gravel or such
type of materials shall not be allowed for
Signature of Bidder Page 7 of
Ahmedabad Municipal Corporation
Providing and Laying of Rubber Moulded
Paver Block Grey/Coloured 60 mm thick, M-
35 Grade of any size ; shape (Usually Uni-
Paver Blocks) using black trap good
quality aggragate of 20 mm nominal size
for footpath, parking areas, service lanes
and other areas as mentioned in the
drawing / instruction of engineer in
charge. Cost includes formworks using
rubber mould, Rate providing and laying
paver blocks as per required grading and
specification. The paver block shall be
mechanically compacted. The work of
paving blocks shall be executed in line and
level by skill mason of flooring work only.
It should be laid in such a way that the no
cutting of the paver block to be necessary. if
cutting of paver block necessary then it
should be cut by machine only and carting.
The finished surface of the paver block shall
have resonably good, plain finished. Paver
blocks shall be compacted and shall be
relaid if necessary. Gravel or such type
of materials shall not be allowed for
production. Laying on 5cms thick sand
Providing and laying of interlocking grey
paver blocks of high density 80mm thick
made from M- 40 grade concrete using
mm to 20 mm machine crushed well
graded stone aggregate, sand of
approved quality, OPC 53 grade cement
with contractor's own concrete mix design as
approved by AMC, for parking, road. Cost
Includes formwork, using rubber/FRP mould,
laying paver block as per required grading and
specification laid paver block shall be
mechanically compacted. The work of the
paving blocks shall be executed in line and
level by skilled mason of flooring work
only. It should be laid in such a way that the
no cutting of the paver block to be
necessary. Cutting of paver block by
machine cut only and carting to be done.
The Finished surface of the Paver Block
shall have reasonably good plain finish.
Paver blocks shall be compacted and shall be
re-laid if necessary. Gravel or such type of
materials shall not be allowed for production.
Laying on 5 Cms thick sand bedding.
Signature of Bidder Page 8 of
Ahmedabad Municipal Corporation
Paver Block Providing and laying shot blasted
Non - interlocking, Paver blocks of specified
thickness, size, grade of concrete and
colour machine made and blasting by
automatic shot blasting machine and high
density of as per approved sample of
approved make for footpath, parking areas,
service lanes,cross over and other areas as
mentioned in the drawing. Including
providing and laying 50 mm thick averave
bedding layer of coarse sand below paver
block as per required grading and
specification. Laid paver block shall
be mechanically compacted. The work of
the paving blocks shall be executed in line
17 and level by skilled mason of flooring work 1000
only. Small size of paver block with same
specification shall be used at residue or at
end. It should be laid in such a way that
the no cutting of the paver block to
be necessary. If cutting of paver block
shall be required , than cut by machine only
and laying to be done by skilled flooring
mason. The finished surface of the paver
block shall have coarse sand Texture Finish.
Pave blocks shall be compacted and shall be
re-laid if necessary. Actual laid area shall
be measured and paid without any wastage.
(A) 60 mm thick M-35 grade Grey Paver
Signature of Bidder Page 9 of
Ahmedabad Municipal Corporation
Paver Block Providing and laying shot blasted
Non - interlocking, Paver blocks of specified
thickness, size, grade of concrete and
colour machine made and blasting by
automatic shot blasting machine and high
density of as per approved sample of
approved make for footpath, parking areas,
service lanes,cross over and other areas as
mentioned in the drawing. Including
providing and laying 50 mm thick averave
bedding layer of coarse sand below paver
block as per required grading and
specification. Laid paver block shall
be mechanically compacted. The work of
the paving blocks shall be executed in line
and level by skilled mason of flooring work
only. Small size of paver block with same
specification shall be used at residue or at
end. It should be laid in such a way that
the no cutting of the paver block to
be necessary. If cutting of paver block
shall be required , than cut by machine only
and laying to be done by skilled flooring
mason. The finished surface of the paver
block shall have coarse sand Texture Finish.
Pave blocks shall be compacted and shall be
re-laid if necessary. Actual laid area shall
be measured and paid without any wastage.
(A) 80 mm thick M-35 grade Grey Paver
block of size 200mm x 200mm.
Labour work of fixing kurb any design of
central verge, (both side) footpath kurb,
items includes necessary excavation,
asphalt cutting of any thickness,
erecting in line and position and
pointing with cement mortar (1:3),
watering, etc complete, filling with zari
along the side of the kurb, the kurb stone
fix prepared with bitumnious top surface, as
directed by engineer in charge.
Provdg. & laying cement concrete 1:5:10
(1 cement : 5 coarse sand : 10 hand
20 broken stone aggregates 40 mm nominal 1500 1,802.24 Cmt
size) and curing complete excluding cost of
Providing TMT Bar FE500D reinforcement
for R.C.C. Work including bending,binding and
placing in position complete upto floor two
Signature of Bidder Page 10 of
Ahmedabad Municipal Corporation
Providing and Casting in situ ordinary
cement concrete M200 for R.C.C. Raft and
cutt off walls including necessary
22 shuttering laying, vibrating, ramming and 200 3,672.30 Cmt
curing complete.(B) Walls, fom top of
foundation level upto floor two level
Providing and setting 50 to 60 mm thick
rouge kotah stone water table in line,
level and in required gradient including
mm thick beddcing in C.M. 1:6 (1 Part of
cement : 6 Part of coarse sand) with
sufficient ramming consolidation.
23 Providing joints in C.M. 1:3 (1 Part of
cement : 3 Part coarse sand) and smooth
pointing in C.M. 1:1 (1 Part of Cement, 1 Part
of coarse sand) including watering etc.
complete and as per details in tender
specification & as directed by engineer in
b Size : 1' x 1'(40 to 50 mm thick) 1000 103.52 Rmt
Construction of RCC nosing in central
verge using M-200 grade cement concrete.
The item includes cost of centering &
24 shuttering, reinforcement, both side 60 4,812.72 No
cement plaster in C:M 1:3 mortar & curing
etc. complete. Half round portion of the
nosing shall be made by using mild steel.
Painting Two Coats on divider and
footpath curb surface / New Concrete
Surface ( Painting two coats after filling the
25 surface with synthetic enamel paint in all 16,000.00 71.86 Smt
shades on new plastered concrete
surfaces) (R & B SOR 2012-13 Item No.
Finishing Wall With Apex Ultima Acrylic Paint
Of " Asian Paint " Or Equivalent On Wall
Surfaces (Two Coats) To Give Required
Even Shade After Application Of Exterior
Primer Of Approved Brand & Manufactures
After Thoroughly Brushing The Surface To
Remove All Dirt & Remains Of Loose
Powered Materials.(
P/F Name Board of 45X60 cm size
showing grant detail with necessary painting
& writing letters as per given inst. & design
Signature of Bidder Page 11 of
Ahmedabad Municipal Corporation
Providing and laying in position Ready
Mixed M- 200 grade concrete for
reinforced cement conctere work, using
cement content as per approved Design
Mix manufactured in fully automatic
batching plant and transported to site of
work in transit mixer for a lead up to
kms having continuous agitated mixer,
manufactured as per mix design of specified
grade for reinforced cement concrete work
28 including pumping of R.M.C. from transit 60 3,922.86 Cmt
mixer to site of laying, excluding the cost of
centering shuttering finishing and
reinforcement including cost of admixtures in
recommended proportions as per IS: 9103 to
accelerate/ retard setting of concrete,
improve workability without impairing
strength and durability as per direction of
the Engineer - in - charge. Without Fly Ash
(Min cement level as per latest IS 456 shall
Providing and supplying of labour for
necessary manual excavation, cleaning,
Shifting of Material Or any other, or for any
other work as directed by Engineer In charge.
a Labour charges - Mazdoor (Male) 400 493 Each
Applying priming coat over new steel and
other metel surface after and including
preparing the surfaceby throughly cleaning,
30 oil,grease, dirt and other foreign matter and 16000 34.34 Smt
scoured with brushes fine steelwood,
scrapers and sand paper with ready mixed
priming paint brushing red lead.
Painting two coats(excluding priming coat) on
new steel and other metal surface with
enamel paint, brushing, interior to give an
31 even shade including cleaning the surface 12,000.00 86.94 Smt
an even shade including cleanicn the
surface of all dirt, dust and other foreign
Providing And FIxing M.S. grill, GAte
Elevation Element of Decorative pattern witth
M.S. channel , Flat medium Grade M.S. pipe
32 , squre Or Round Bars With Round Heanded 10000 68 Kg
bolts , Nuts or By screw incl. Applying One
coat Zinc Primer And Two coat Of Oil Paint
ETC comp (App rate)
33 Welder / Gas cutter At Day/Night 40 689 No
Signature of Bidder Page 12 of
Ahmedabad Municipal Corporation
Hiring and operating the 20 KV 3 Phase
Electric Generator for operating desilting
34 machinery, andlighting and other 150 2,800.00 Shift
requirements with Arranging diesel to run
the D.G. Set Do As Directed. 8 Hrs Shift.
Supplting of welding machine / gas cutter
including cost of welding rods/gas,
Transportation, including carting from site to
Providing and fixing Swiss type Bollard
made out of 1.5mm CRC sheet, height
cms, bottom dia 23cm, top dia 12cm with
direction plate of 30 cm dia fabricated
necessary anchors as directed and also
provide through out lengh pipe of 25 NB for
the strenthing of bollard and reflectorised
Micro Prismatic Grade Sheet (Type-XI) and
three yellow strip 6 Inches wide of Type-XI
Retro reflective Sheeting, fixing with
P.C.C M-25 grade concrete (Foundation size
Supplying And Fixing Jumbo Bollard Swiss
Type Made out of 1.5 cm crc sheet height
188 cms. Bottom dia 30 cms. Top dia 18 cm.
With direction plate of 45cm dia. Fabricated
37 as per attached drawing, pre treated with 150 5,687.75 Nos.
phospheting process painted with apoxy
coating reflectorised with retro reflective
sheetings specified by M.O.R.T & H.'s latest
specification. (B) High Intensity Grade.
Supply recycled products manufactured by
Amdavad Enviro project pvt ltd (AEPPL)
Rubber mould paver Block ( 60 mm thick M -
b planter ( size 760 x 760 x 660 mm ) 100 1600 nos
c planter ( size 1280 x 600 x 370 mm ) 100 1710 nos
d garden kerb (Size 300 mm x 300 x 75 mm) 1003 91 rmt
e foothpath kerb (size 380 x 300 x150 mm) 5000 177.75 rmt
f central verge (size 380 x 300 x 200 mm) 4500 390 rmt
Supplying, labour for Transportation of
recycled products manufactured by Amdavad
Enviro project pvt ltd (AEPPL) incl loading
from product manufacturing site and
unloading at diff. site or AMC road stores
comp. as directed by engineer in charge.
a Labour charges - Mazdoor (Male, Female) 159 493 No.
Signature of Bidder Page 13 of
Ahmedabad Municipal Corporation
Hiring of Tractor with trolley considering
hrs. as working day hours incl. Driver
Transportation of recycled products
manufactured by Amdavad Enviro project pvt
ltd (AEPPL) incl loading from product
manufacturing site and unloading at diff. site
or AMC road stores comp. as directed by
engineer in charge.
Seal and Signature of the Bidder Add City Engineer
Date: Ahmedabad Municipal Corporation
Signature of Bidder Page 14 of
Tap a document below to read it instantly. You can also download everything as a ZIP if you prefer.
details.html
RAW_HTML
TENDER NO.606.pdf
Download all tender documents and submit your bid